Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate 8500849 DvMF_1587 ABC transporter related (RefSeq)
Query= uniprot:D4GP38 (383 letters) >FitnessBrowser__Miya:8500849 Length = 366 Score = 217 bits (552), Expect = 5e-61 Identities = 121/294 (41%), Positives = 179/294 (60%), Gaps = 12/294 (4%) Query: 1 MGQIQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDI 60 M I L + K +G +D LSL ++ E L+GPSGCGK+ LR++AG ETP +G I Sbjct: 1 MADITLAGIGKAYGAHAVLDGLSLTVNHGECFTLLGPSGCGKTVLLRLIAGFETPDAGTI 60 Query: 61 YIGGDHMNYRV------PQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDER 114 IGG+ ++ V P RD+ +VFQDYA++PHM+V NI + L+ G +AER + Sbjct: 61 SIGGEPVSDAVTGDCVPPDARDLGVVFQDYAVWPHMSVADNIGYPLKLA-GLPAAERTRQ 119 Query: 115 VVEVAETLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMR 174 V+E E + + L +R P +LSGGQQQRVAL RA+V P + L+DEPL NLDA LR EMR Sbjct: 120 VLETVEMVNLTGLENRMPSQLSGGQQQRVALARALVGRPSLMLLDEPLCNLDANLREEMR 179 Query: 175 TELQNLQDQLAVTTVYVTHNQTEAMTMADRIAVMDD-GELQQVASPFECYHEPNNLFVAE 233 E++ LQ L +T +YVTH+Q A+ ++DR+A+MD G ++QV +P+E + P + FV Sbjct: 180 FEIKELQRTLGITILYVTHDQEIALAISDRLAIMDHAGAIRQVGTPWEIFERPADEFVFR 239 Query: 234 FIGEPMINLVRGTRSESTFVGEHFSYPLDEDVMESVDDRDDFVLGVRPEDIEVA 287 F+G + N + R + P+ + + D + ++ G RP D+ +A Sbjct: 240 FMG--VANFLPARRRGMAMLAAGGEQPVPWGLPDG--DAEHWMAGFRPSDVRLA 289 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 366 Length adjustment: 30 Effective length of query: 353 Effective length of database: 336 Effective search space: 118608 Effective search space used: 118608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory