Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate 8499890 DvMF_0655 ABC transporter related (RefSeq)
Query= uniprot:D4GP39 (383 letters) >FitnessBrowser__Miya:8499890 Length = 350 Score = 271 bits (692), Expect = 3e-77 Identities = 160/357 (44%), Positives = 212/357 (59%), Gaps = 37/357 (10%) Query: 19 GDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRLEDRVLNGVSAQ 78 GD+ AV+++S +++ G LVL+GPSGCGKSTTLR++AGLE+VT G + + +R + + Sbjct: 14 GDVRAVDDVSFEVEQGTMLVLLGPSGCGKSTTLRLIAGLESVTSGRIMIGERDVTHLPPA 73 Query: 79 DRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVEETTDMLGISDLLDRKPG 138 R +AMVFQSYAL+PH +VR N+ FGL +P+ E +R+ D+LG+S LL RKPG Sbjct: 74 QRQLAMVFQSYALFPHLTVRENILFGLTVRK-VPEAEREKRLTRAVDILGLSALLQRKPG 132 Query: 139 QLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQGELGVTTVYVTH 198 +LSGGQQQRVALGRA+V + V LMDEPLSNLDAKLR EMR E++ LQ LG+T VYVTH Sbjct: 133 ELSGGQQQRVALGRALVAEAAVCLMDEPLSNLDAKLRHEMRREIRALQQTLGMTMVYVTH 192 Query: 199 DQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFIGEPSMNL----------- 247 DQTEAM+M DR+ ++ G + Q TP + Y RP F FIG P MNL Sbjct: 193 DQTEAMSMADRIILMQGGRIVQNATPSELYSRPATTFAGNFIGTPPMNLVRLDDARGSVC 252 Query: 248 FDGSLSGDTFRGDGFDYPLSGATRDQLGGASGLTLGIRPEDVTVGERRSGQRTFDAEVVV 307 GS SG D DY LGIRPE + R + A V Sbjct: 253 VAGSRSGTVSVVDSADY----------------VLGIRPEHI-----RIVPEGWRAVVES 291 Query: 308 VEPQGNENAVHLRFVDGDEGTQFTATTTGQSRVEAGDRTTVSFPEDAIHLFDGETGD 364 VE G+ + + R V G+E + G + G + P++ IH+FD +TG+ Sbjct: 292 VEYLGSGSVLGCR-VGGEE---LSVVVDGVPTIAVGAEIYLHCPDEHIHIFDAKTGE 344 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 350 Length adjustment: 30 Effective length of query: 353 Effective length of database: 320 Effective search space: 112960 Effective search space used: 112960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory