Align N-carbamoylputrescine amidase; EC 3.5.1.53 (characterized)
to candidate 8499888 DvMF_0653 N-carbamoylputrescine amidase (RefSeq)
Query= SwissProt::Q9XGI9 (300 letters) >FitnessBrowser__Miya:8499888 Length = 313 Score = 356 bits (914), Expect = e-103 Identities = 173/288 (60%), Positives = 211/288 (73%), Gaps = 4/288 (1%) Query: 8 VTVAALQFACTDDVSTNVATAERLVRAAHQKGANIILIQELFEGYYFCQAQKEEFFHRAK 67 V VAA Q ACTD+ S N+ LVR A GA+I+L QELF G YFC+ + E F A+ Sbjct: 4 VIVAATQMACTDNESRNIDRVCELVREAAAMGAHIVLPQELFSGPYFCKDELPEHFALAR 63 Query: 68 PYPGHPTIVRMQNLAKELGVVIPVSFFEEANNAHYNSVAIIDADGTDLGLYRKSHIPDGP 127 P P + RM LA ELGVVIPVSFFE +N +YNS+A+IDADG +GLYRKSHIP GP Sbjct: 64 PLDESPAVRRMSALAAELGVVIPVSFFERSNQVYYNSLAMIDADGRVMGLYRKSHIPQGP 123 Query: 128 GYQEKYYFNPGDTGFKVFQTKYAKIGVAICWDQWFPEAARAMALQGAEVLFYPTAIGSEP 187 GY+EK+YF+PGDTGF+V++T+Y +GV +CWDQWFPE AR+MAL GA+VL YPTAIGSEP Sbjct: 124 GYEEKFYFSPGDTGFRVWRTRYGTVGVGVCWDQWFPECARSMALLGADVLLYPTAIGSEP 183 Query: 188 QDDGLDSRDHWRRVMQGHAGANVVPLVASNRIGKEIIETEHGNSEITFYGYSFIAGPTGE 247 + DS HW R MQGHA AN++PLVASNR+G+E + +TFYG SFIAGP GE Sbjct: 184 AEPACDSSGHWTRTMQGHAAANMMPLVASNRVGEEFGK----GFSMTFYGSSFIAGPQGE 239 Query: 248 LVAAAGDKEEAVLVAQFDLDKIKSKRHGWGVYRDRRPDLYKVLLTLDG 295 +V AG EE VL A FD + I+++R GWG++RDRRPDLY LLT DG Sbjct: 240 IVQQAGRSEECVLTAAFDFEAIRAERAGWGLFRDRRPDLYHPLLTFDG 287 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 313 Length adjustment: 27 Effective length of query: 273 Effective length of database: 286 Effective search space: 78078 Effective search space used: 78078 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate 8499888 DvMF_0653 (N-carbamoylputrescine amidase (RefSeq))
to HMM TIGR03381 (aguB: N-carbamoylputrescine amidase (EC 3.5.1.53))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03381.hmm # target sequence database: /tmp/gapView.14952.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03381 [M=279] Accession: TIGR03381 Description: agmatine_aguB: N-carbamoylputrescine amidase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-142 459.0 0.0 3.2e-142 458.8 0.0 1.0 1 lcl|FitnessBrowser__Miya:8499888 DvMF_0653 N-carbamoylputrescine Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8499888 DvMF_0653 N-carbamoylputrescine amidase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 458.8 0.0 3.2e-142 3.2e-142 1 278 [. 4 281 .. 4 282 .. 0.99 Alignments for each domain: == domain 1 score: 458.8 bits; conditional E-value: 3.2e-142 TIGR03381 1 vkvaavqlalsedveeniekaeklvreaaakGaqiillpelfeapyfckeqeeeyfelakpveehplikrlqklake 77 v vaa+q+a++++ ++ni+++ +lvreaaa Ga+i+l++elf++pyfck++ e+f+la+p++e+p+++r+++la+e lcl|FitnessBrowser__Miya:8499888 4 VIVAATQMACTDNESRNIDRVCELVREAAAMGAHIVLPQELFSGPYFCKDELPEHFALARPLDESPAVRRMSALAAE 80 569************************************************************************** PP TIGR03381 78 levvlpvsffekagnalynslavidadGevlgvyrkshiPdgpgyeekfyfkpGdtGfkvwdtryakiGvgicWdqW 154 l+vv+pvsffe++++++ynsla+idadG+v+g+yrkshiP+gpgyeekfyf+pGdtGf+vw+try+ +Gvg+cWdqW lcl|FitnessBrowser__Miya:8499888 81 LGVVIPVSFFERSNQVYYNSLAMIDADGRVMGLYRKSHIPQGPGYEEKFYFSPGDTGFRVWRTRYGTVGVGVCWDQW 157 ***************************************************************************** PP TIGR03381 155 fpeaaralalkGaevllyPtaiGsePadaeldskehWqramqGhaaanvvpvvaanrigkeveaeleltfyGssfia 231 fpe+ar++al Ga+vllyPtaiGsePa+++ ds+ hW+r+mqGhaaan++p+va+nr+g+e ++ ++tfyGssfia lcl|FitnessBrowser__Miya:8499888 158 FPECARSMALLGADVLLYPTAIGSEPAEPACDSSGHWTRTMQGHAAANMMPLVASNRVGEEFGKGFSMTFYGSSFIA 234 ***************************************************************************** PP TIGR03381 232 detGelvaeadrseeavlvaefdldeiakeraawGlfrdrrpelyek 278 +Ge+v++a+rsee vl+a fd+++i++era wGlfrdrrp+ly+ lcl|FitnessBrowser__Miya:8499888 235 GPQGEIVQQAGRSEECVLTAAFDFEAIRAERAGWGLFRDRRPDLYHP 281 *********************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (279 nodes) Target sequences: 1 (313 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.68 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory