Align arginine ABC transporter, periplasmic arginine-binding protein ArtJ (characterized)
to candidate 8500596 DvMF_1344 extracellular solute-binding protein family 3 (RefSeq)
Query= CharProtDB::CH_002541 (243 letters) >FitnessBrowser__Miya:8500596 Length = 272 Score = 104 bits (260), Expect = 2e-27 Identities = 72/227 (31%), Positives = 111/227 (48%), Gaps = 8/227 (3%) Query: 19 AAEKINFGVSATYPPFESIGANNEIVGFDIDLAKALCKQMQAECTFTNHAFDSLIPSLKF 78 A ++ G A Y PFE N VGFDIDLAK L K M + N FD +IP+L Sbjct: 38 ARGELRVGFDAGYMPFEMTDKNGNYVGFDIDLAKELAKAMGVKFVPVNTDFDGMIPALLS 97 Query: 79 RKYDAVISGMDITPERSKQVSFTTPY-YENSAVVIAKK--DTYKTFADLKGKRIGMEN-- 133 K+D +ISGM +T ER+ +++F PY +V+++KK KT+ DL + + Sbjct: 98 DKFDIIISGMTVTQERNLRINFANPYIVVGQSVIVSKKHEGKVKTWEDLNKPEYTVVSRL 157 Query: 134 GTTHQKYIQDQHPEVKTVSYDSYQNAFIDLKNGRIDGVFGDTAVVNEWLKTNPQLGVATE 193 GTT ++ + P+ K S++ + +++ NG+ D D N G A Sbjct: 158 GTTGEEAAKRMLPKAKYKSFEKEADGALEVINGKADAWVYDMP-FNVVFMAEQGKGKAIH 216 Query: 194 KVTDPQYFGTGLGIAVRPDNKALLEKLNNALAAIKADGTYQKISDQW 240 D + LG ++ + L L+N L+ IK DG Y +I ++W Sbjct: 217 --LDKPFTYEPLGFGIKKGDPDFLNFLDNFLSQIKNDGRYDRIYNKW 261 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 243 Length of database: 272 Length adjustment: 24 Effective length of query: 219 Effective length of database: 248 Effective search space: 54312 Effective search space used: 54312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory