Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate 8500098 DvMF_0861 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
Query= reanno::pseudo3_N2E3:AO353_03045 (232 letters) >FitnessBrowser__Miya:8500098 Length = 263 Score = 122 bits (306), Expect = 7e-33 Identities = 71/214 (33%), Positives = 108/214 (50%), Gaps = 10/214 (4%) Query: 9 WEALPLYFGGLVTTLKLLALSLLFGLLAALPLGLMRVSKQPIVNMSAWLYTYVIRGTPML 68 W L G+ T K+ LS+L + L GL R+S+ ++N+ A Y V+RG P+L Sbjct: 53 WRLLQFLPDGIAVTFKVTVLSILCSIPIGLITGLGRLSRNRLINLVASTYVEVVRGIPLL 112 Query: 69 VQLFLIYYGLAQFEAVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSLRATPNGEI 128 VQLF IYY L +F V + A +A ++ AY E+ + + G+ Sbjct: 113 VQLFYIYYALGRFLKVPD----------LLAAIIALSVCYGAYMGEVFRAGIDSISKGQT 162 Query: 129 EAAKAMGMSRFKMYKRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITGAARTVN 188 EAA+++G +R + ++LP A R LP NE I ML+ TSL SI+ + DI R Sbjct: 163 EAARSLGFNRAETMFMVILPQAWRTILPPVGNEFIAMLKDTSLVSIIAVADILRRGREFA 222 Query: 189 AQYYLPFEAYITAGVFYLCMTFILVRLFKMAEHR 222 ++ +L FE Y + YL +T L + + E R Sbjct: 223 SESFLYFETYTMVALIYLLITLFLSKGVSIMESR 256 Lambda K H 0.329 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 263 Length adjustment: 24 Effective length of query: 208 Effective length of database: 239 Effective search space: 49712 Effective search space used: 49712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory