Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate 8500594 DvMF_1342 ABC transporter related (RefSeq)
Query= SwissProt::P54537 (240 letters) >FitnessBrowser__Miya:8500594 Length = 243 Score = 274 bits (701), Expect = 1e-78 Identities = 144/243 (59%), Positives = 176/243 (72%), Gaps = 3/243 (1%) Query: 1 MIKVEKLSKSF---GKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGT 57 MI + K F K L+ +S ++A GEVV +IGPSGSGKSTFLRCLN LE + G Sbjct: 1 MINATNVHKFFYTPDKLHALRGVSLSVAPGEVVVIIGPSGSGKSTFLRCLNRLEYADEGA 60 Query: 58 ITIKDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEKA 117 I I+ +I P +VR +GMVFQ F+LFPH TVLEN+ A V+K K A++K Sbjct: 61 IRIEGRDILDPDCEINEVRAEVGMVFQSFNLFPHLTVLENLTLAQTTVRKRGKAEAEKKG 120 Query: 118 EDLLRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVKEVLQ 177 +LLRKVG+ EK N YP++LSGGQ+QRVAIARALAM+P MLFDEPTSALDPEMV EVL Sbjct: 121 MELLRKVGIAEKHNVYPDQLSGGQQQRVAIARALAMDPKAMLFDEPTSALDPEMVGEVLD 180 Query: 178 VMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFLE 237 VMK L GMTMV+VTHEMGFA+EVADRV+FMDQG I+E G+P +FF +P+ R + FL Sbjct: 181 VMKNLAREGMTMVVVTHEMGFAREVADRVVFMDQGSILEVGSPDKFFTAPEHDRTKLFLS 240 Query: 238 KIL 240 +IL Sbjct: 241 QIL 243 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 243 Length adjustment: 23 Effective length of query: 217 Effective length of database: 220 Effective search space: 47740 Effective search space used: 47740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory