GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astD in Desulfovibrio vulgaris Miyazaki F

Align N-succinylglutamate 5-semialdehyde dehydrogenase; EC 1.2.1.71; Succinylglutamic semialdehyde dehydrogenase; SGSD (uncharacterized)
to candidate 8501416 DvMF_2146 delta-1-pyrroline-5-carboxylate dehydrogenase (RefSeq)

Query= curated2:Q2G9T9
         (471 letters)



>lcl|FitnessBrowser__Miya:8501416 DvMF_2146
           delta-1-pyrroline-5-carboxylate dehydrogenase (RefSeq)
          Length = 1013

 Score =  195 bits (496), Expect = 5e-54
 Identities = 135/442 (30%), Positives = 214/442 (48%), Gaps = 14/442 (3%)

Query: 6   IVSHEPATGAEV----WRGKVGDVEEVVARARRAWPAWAAQPLATRIELVRRFANEVRKD 61
           I S  PA  AEV     +G   +V+  +  A++A+PAW     A R   + R A+  R+ 
Sbjct: 534 IASTNPAKPAEVIARVCQGGKPEVDAAIEAAQKAFPAWRDTSPADRAMFLHRAADIARRR 593

Query: 62  ADNLATMISRETGKPLWEARTEVDSVVNKVEISIRAYADRTSQRKLDSALQGTAALRHKP 121
              L+     E GK   +A  +V   ++ ++          + R++  A      L ++P
Sbjct: 594 MFELSAWQVLEVGKQWDQAFHDVGEGIDFLDYYAHEMLRLGTPRRMGRAPGELNHLFYQP 653

Query: 122 HGVLAVLGPYNFPAHLPNGHIVPALIAGNAVVFKPSEKTPATGEMLAQCFHRAGIPAAVV 181
            G+ AV+ P+NFP  +  G    A++ GN V+FKPS      G  L + F  AG+P  V 
Sbjct: 654 KGIAAVIAPWNFPFAIAIGMAAAAIVTGNPVIFKPSSIASRIGYNLTEIFREAGLPEGVF 713

Query: 182 QVLIG-GPEEGQALVAHDGIDGVLFTGSAHAGIAINRKLAS-NPG----KIVALEMGGNN 235
             + G     G  LV H  +  + FTGS   G+ I  K A   PG    K V  EMGG N
Sbjct: 714 NYVPGRSSVMGDYLVEHPQVSMICFTGSMEVGLRIQEKAAKVQPGQMQCKRVIAEMGGKN 773

Query: 236 PIVVWDTPKIEDAATLIVQSAFTSAGQRCTAARRLIIKASMFDEVIDHVKRLADRIIVGA 295
            I++ D   +++A   ++ SAF   GQ+C+A  R+I+   ++D  ++ + + A  I +G 
Sbjct: 774 AIIIDDDADLDEAVLQVLYSAFGFQGQKCSACSRVIVLDPIYDRFVERLVKAAQAIKIG- 832

Query: 296 PFDDPAPFMGPVIDNRTADGLTESFVYLLSSGGRPIKHMVRLQEDRPFLSPAIIDVTAVA 355
           P +DPA +MGPV D      + E +V +    G+ +     +  +  ++   I++     
Sbjct: 833 PSEDPANYMGPVADASLQKNILE-YVKVAEQEGKVLVKRTDIPAEGCYVPLTIVEGIKPH 891

Query: 356 DR-PDVELFGPLLQVVRVDDFDEAIAEANNTRFGLSASLIGGDPQDYNRFWANIRAGVVN 414
            R    E+FGP+L V+R  +FDEA+A AN TRF L+  +    P++  +     R G + 
Sbjct: 892 HRIAQEEIFGPVLAVMRAGNFDEALAIANGTRFALTGGVFSRSPENLTKARREFRVGNLY 951

Query: 415 WNRPTNGAS-SAAPFGGVGLSG 435
            NR + GA     PFGG  +SG
Sbjct: 952 LNRGSTGAMVERQPFGGFKMSG 973


Lambda     K      H
   0.319    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1086
Number of extensions: 51
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 471
Length of database: 1013
Length adjustment: 39
Effective length of query: 432
Effective length of database: 974
Effective search space:   420768
Effective search space used:   420768
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory