Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate 8500245 DvMF_1002 adenosylmethionine-8-amino-7-oxononanoate aminotransferase (RefSeq)
Query= reanno::SB2B:6938540 (460 letters) >FitnessBrowser__Miya:8500245 Length = 491 Score = 230 bits (587), Expect = 7e-65 Identities = 138/456 (30%), Positives = 233/456 (51%), Gaps = 10/456 (2%) Query: 12 LQAMDAAHHLHPFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAGLWCVNVGYGRK 71 L+A+D AH HPFT D VI AEG + D G LD ++ LW G+ Sbjct: 27 LRALDKAHVWHPFTQMRDWLAADPLVIGAAEGNRLTDTDGVSYLDGVSSLWTNVHGHRHP 86 Query: 72 SIADAAYAQLQTLPFYNNFFQCTHEPAIRLASKIASLAPGHMNRVFFTGSGSEANDTNLR 131 + A AQL + + EP+I LA+++A++AP + RVF++ SGS + + L+ Sbjct: 87 RLDAAIRAQLDKVA-HTTLLGLGSEPSIELAARLAAIAPQGLTRVFYSDSGSTSVEVALK 145 Query: 132 MVRRYW-----DLKGMPSKKTIISRKNAYHGSTVAGASLGGMGFMHQQGDLPIPGIVHID 186 + ++ L G + +S +NAYHG TV +LGGM H + V + Sbjct: 146 IAFQFHRQAPAHLGGDARRTRFLSLRNAYHGDTVGAVALGGMALFHSIYAPLLFDTVKAE 205 Query: 187 QPYWFGEGRDMSPEAFGIKTAQALEAKILELGEDKVAAFIAEPFQGAGGVIIPPDSYWNE 246 PY + + + +E G + AA + QGA G+++ P + Sbjct: 206 SPYCYRCPFGRQAGSCERECITHMETLFARHGHELCAAVVEPLVQGAAGMLLQPPGWLRR 265 Query: 247 IKRILEKYNILFILDEVISGFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMGGVIVSD 306 ++ + +++ + + DEV GFG+TG FA + G+ PD + +AKG++ GY+P+ + ++ Sbjct: 266 VRELCDEHGVFLVADEVAVGFGKTGTLFACEQEGVTPDFLCLAKGISGGYLPLAATLTTE 325 Query: 307 RVADVLISDGGE---FAHGFTYSGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQDRL 363 RV D ++ E F HG TY+G+P+A A A+ ++ + EEER++++++ L RL Sbjct: 326 RVHDGFLARHEELRTFFHGHTYTGNPLACAAAIASLDVFEEERVMERLQPKIA-RLAARL 384 Query: 364 QTLSAHPLVGEVRGMGMVGAIELVADKHSMVRFGSEISAGMLCREACIESGLVMRAVGDT 423 TL P VG++R G++ IE+V ++ + + + G G+++R +GD Sbjct: 385 DTLRDLPHVGDIRQRGVMTGIEMVRNRATKEAYDLALRVGHRVTLEARRRGVIIRPLGDV 444 Query: 424 MIISPPLCITRDEIDELIFKASQALSLTLEKIAARG 459 M++ PPL IT DEID L+ +A+ E+ A G Sbjct: 445 MVLMPPLSITDDEIDLLVGATGEAIRAVTERGATGG 480 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 586 Number of extensions: 36 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 491 Length adjustment: 33 Effective length of query: 427 Effective length of database: 458 Effective search space: 195566 Effective search space used: 195566 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory