Align PP1069, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate 8500098 DvMF_0861 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
Query= TCDB::Q88NY4 (223 letters) >FitnessBrowser__Miya:8500098 Length = 263 Score = 114 bits (285), Expect = 2e-30 Identities = 70/211 (33%), Positives = 113/211 (53%), Gaps = 8/211 (3%) Query: 12 LPALWEGMVMTLKLMVMGVIGGIVLGTILALMRLSSSKLLSNLAGAYVNYFRSIPLLLVI 71 L L +G+ +T K+ V+ ++ I +G I L RLS ++L++ +A YV R IPLL+ + Sbjct: 56 LQFLPDGIAVTFKVTVLSILCSIPIGLITGLGRLSRNRLINLVASTYVEVVRGIPLLVQL 115 Query: 72 TWFYLAVPFVLRWITGEDTPVGAFTSCVVAFMMFEAAYFCEIVRAGVQSISKGQMGAAQA 131 + Y A+ G V + ++A + AY E+ RAG+ SISKGQ AA++ Sbjct: 116 FYIYYAL--------GRFLKVPDLLAAIIALSVCYGAYMGEVFRAGIDSISKGQTEAARS 167 Query: 132 LGMNYAQTMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFLNSARSNGDIIGR 191 LG N A+TM ++ILPQA+R + P + + I + +DTSLV + + D L R Sbjct: 168 LGFNRAETMFMVILPQAWRTILPPVGNEFIAMLKDTSLVSIIAVADILRRGREFASESFL 227 Query: 192 SHEFLIFAGVVYFLISFSASWLVKRLQKRIS 222 E ++Y LI+ S V ++ R++ Sbjct: 228 YFETYTMVALIYLLITLFLSKGVSIMESRLN 258 Lambda K H 0.330 0.141 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 263 Length adjustment: 23 Effective length of query: 200 Effective length of database: 240 Effective search space: 48000 Effective search space used: 48000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory