Align Extracellular solute-binding protein, family 3 (characterized, see rationale)
to candidate 8502446 DvMF_3152 extracellular solute-binding protein family 3 (RefSeq)
Query= uniprot:Q31RP1 (359 letters) >FitnessBrowser__Miya:8502446 Length = 271 Score = 120 bits (301), Expect = 4e-32 Identities = 76/240 (31%), Positives = 121/240 (50%), Gaps = 13/240 (5%) Query: 23 LCFLPLAACRSLGGNETESNSRLNQVQARGKLLCGVEGRLPGFSFLDSQGNYS-GLDVDI 81 L L +A C L G + ++ ++ARG L+CGV+ F ++D Q G D+DI Sbjct: 4 LVLLAVALCVVLTGTMAHAG-KIEDIKARGALVCGVKDSTVPFGYIDEQSKQIVGFDIDI 62 Query: 82 CKAIAAALFNDPKAIEYRSLDSVERFPALASGEVDLLSRNTTWTLSRDAKGGNNLEFAPT 141 CKA+A L +E +++ S R P L G VD+++ T RD + ++F+ T Sbjct: 63 CKAVADKL---GVKLELKTVTSATRIPMLTQGSVDMVAATMTHKFERD----DVIDFSIT 115 Query: 142 TFYDGQGLMVRRNSGIQSLQDFQGKSICVETGTTSELNLADTMRELGVQYQEIKFPNSDA 201 F DGQ L+V++ G++S D +GK + G+TSE N+ E V + F Sbjct: 116 YFMDGQKLLVKKGGGVKSAADLKGKKVATAKGSTSEKNIKAAQPEATV----VSFDEYPQ 171 Query: 202 NYAAYAQGRCEGVTSDRSQLAARRTTLSDADQHQLLDAVISKEPLSPATLNNDSPWFDVV 261 + A QG+ E VT+D + L R + + D+ +++ IS EP NDS + D+V Sbjct: 172 AFLALKQGKAEAVTTDSTILLGLRNSDPEPDKWEIVGDYISPEPYGLGLAENDSKFRDLV 231 Lambda K H 0.317 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 271 Length adjustment: 27 Effective length of query: 332 Effective length of database: 244 Effective search space: 81008 Effective search space used: 81008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory