Align ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)
to candidate 8502075 DvMF_2788 ABC transporter related (RefSeq)
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4773 (244 letters) >FitnessBrowser__Miya:8502075 Length = 243 Score = 305 bits (782), Expect = 4e-88 Identities = 153/245 (62%), Positives = 186/245 (75%), Gaps = 3/245 (1%) Query: 1 MISIKSINKWYGD-FQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDIV 59 MI ++KWY VL D + E+K+GEV+V+CGPSGSGKSTLI+C+N LEP QKG IV Sbjct: 1 MIKFDHVHKWYASGLHVLQDITLEIKQGEVVVICGPSGSGKSTLIRCINKLEPIQKGHIV 60 Query: 60 VDGTSIADPKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATKKGLQ 119 VDG I DP+TNL LR+ VG VFQ F L+PH+T+ EN+T+A + V + EA K ++ Sbjct: 61 VDGVDINDPRTNLTMLRAEVGFVFQQFNLYPHMTVLENITLAPLLVRNTPRAEAEKTAME 120 Query: 120 LLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDVM 179 LLE+V + A +PGQLSGGQQQRVAIAR LAM P +MLFDEPTSALDPEM+NEVLDVM Sbjct: 121 LLEKVNIPDKAGAYPGQLSGGQQQRVAIARGLAMKPRIMLFDEPTSALDPEMINEVLDVM 180 Query: 180 VQLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDINARAERTQHFLN 239 QLA EGMTM+CVTHEMGFAR+VADRVIFMDQG ++E+ E FF N +RT+ FL+ Sbjct: 181 RQLAREGMTMVCVTHEMGFAREVADRVIFMDQGVMVEENTPEAFFS--NPVHDRTKEFLS 238 Query: 240 KILQH 244 KIL H Sbjct: 239 KILTH 243 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 243 Length adjustment: 24 Effective length of query: 220 Effective length of database: 219 Effective search space: 48180 Effective search space used: 48180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory