Align ABC-type permease for basic amino acids and glutamine (characterized, see rationale)
to candidate 8501972 DvMF_2686 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
Query= uniprot:Q31RP0 (377 letters) >FitnessBrowser__Miya:8501972 Length = 316 Score = 92.4 bits (228), Expect = 1e-23 Identities = 52/128 (40%), Positives = 73/128 (57%) Query: 245 FTALLLGLVAYTGAFITEIIRGGILSVPAGQWEAAAALGLTRSQTLWQIVVPQALRVIVP 304 F A +L L + GA+I EI+R GILSVP GQWEA+ +LG+ T ++V+PQA R +P Sbjct: 186 FAAGVLALSLFEGAYIAEILRAGILSVPTGQWEASRSLGMDVPGTYMEVVLPQAARTALP 245 Query: 305 SLNSQYVGFAKNSSLAIAVGYPDLYATAQTTLNQTGRPVEVFLILMLTYLAINAVISAGM 364 L Q V K+SSL + DL AQ T EV+ ++ YLA+ +SA Sbjct: 246 PLTGQLVSLVKDSSLVSTIALHDLAMQAQAVAADTFLVFEVWFLVAGMYLALTLSLSALA 305 Query: 365 NGLQQRLQ 372 L++RL+ Sbjct: 306 QLLERRLR 313 Score = 45.1 bits (105), Expect = 3e-09 Identities = 28/65 (43%), Positives = 39/65 (60%) Query: 79 ARALVVGLVNSLRVIAIGLILTTVIGTLAGVAAFSENWLLRQLSRGYVAVVRNTPLLLQL 138 A L+ GL +++V+A L L + G LA + S + + R L+ YV VRNTPLL+QL Sbjct: 111 AGPLLDGLGVTVQVVAASLGLALLAGLLAALLRQSGSRVGRALAVAYVETVRNTPLLIQL 170 Query: 139 IVWYF 143 V YF Sbjct: 171 FVVYF 175 Lambda K H 0.326 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 316 Length adjustment: 29 Effective length of query: 348 Effective length of database: 287 Effective search space: 99876 Effective search space used: 99876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory