GapMind for catabolism of small carbon sources

 

Aligments for a candidate for peb1B in Desulfovibrio vulgaris Miyazaki F

Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate 8502073 DvMF_2786 polar amino acid ABC transporter, inner membrane subunit (RefSeq)

Query= TCDB::A1VZQ3
         (250 letters)



>lcl|FitnessBrowser__Miya:8502073 DvMF_2786 polar amino acid ABC
           transporter, inner membrane subunit (RefSeq)
          Length = 596

 Score =  128 bits (322), Expect = 2e-34
 Identities = 74/230 (32%), Positives = 128/230 (55%), Gaps = 6/230 (2%)

Query: 18  WGLYDENSISPFAVWKFLDAL-DNKDAFINGFIYTLEVSILALLIATIFGTIGGVMATSR 76
           W +  EN +    +W F     D     + G  Y+L ++++A+ ++   G   GV  +S 
Sbjct: 360 WHVVFEN-LRSLLIWHFPTGRPDEMFLGLGGLAYSLLMAVIAISVSFFIGLAVGVGRSSS 418

Query: 77  FKIIRAYTRIYVELFQNVPLVIQIFFLFYALPVL-GIRLDIFTIGVLGVGAYHGAYVSEV 135
            ++ R    +Y+EL +  PL+I IF++++ +PV+ G  L++F      + A+ GAY++E+
Sbjct: 419 NRVFRIPCLLYIELIRGNPLIIVIFWVYFFIPVMFGTTLNVFWSATWALTAFTGAYIAEI 478

Query: 136 VRSGILAVPRGQFEASASQGFTYIQQMRYIIVPQTIRIILPPMTNQMVNLIKNTSVLLIV 195
           VR+GI  +P GQ EA+ S G TY+Q MR I++PQ ++ ++P +  Q + + K+TS+  ++
Sbjct: 479 VRTGIQNIPAGQVEAAYSTGLTYLQAMRRIVLPQALKQMIPAIVGQFIAIFKDTSLAFVL 538

Query: 196 GGAELMHSADSYAADYGNYAPAYIFAAV--LYFIICYPLAYFAKAYENKL 243
           G  EL   A         + P  I+  V  LYFI CY ++ FA   E +L
Sbjct: 539 GVLELTFVAQGINNRLMIH-PMEIYGTVAFLYFICCYSMSVFAARLERRL 587



 Score =  115 bits (289), Expect = 2e-30
 Identities = 61/209 (29%), Positives = 116/209 (55%), Gaps = 9/209 (4%)

Query: 45  INGFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELFQNVPLVIQIFFLF 104
           + G   T+ +S+++  +A + GT+ G+   S F+ +R      +E F+N PL+IQ+FF +
Sbjct: 58  LKGLANTVRISLISSALALLLGTMLGLARLSLFRPLRVTATCVIEFFRNTPLLIQLFFWY 117

Query: 105 YALPVL---GIRLDIFTI------GVLGVGAYHGAYVSEVVRSGILAVPRGQFEASASQG 155
           +A P +     R  +F+I        +G+  Y  ++++EV+R+G+ ++P+G  EA+ S G
Sbjct: 118 FAFPAILPDNAREALFSIQFEFWCATIGLSIYTASFMAEVIRAGLQSIPKGLLEAAYSSG 177

Query: 156 FTYIQQMRYIIVPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSADSYAADYGNYA 215
            +Y Q +R II+P   R I+PP+ ++ +N +KN+S+ ++VG AEL   A    +      
Sbjct: 178 LSYFQVLRTIILPLAFRAIIPPLGSEFLNNMKNSSLAMVVGVAELTWHAQQVESLTFKGF 237

Query: 216 PAYIFAAVLYFIICYPLAYFAKAYENKLK 244
            A   A VLY  +   +++       +++
Sbjct: 238 EATSAATVLYLSLSLIISFILNGVNGRMR 266


Lambda     K      H
   0.328    0.143    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 378
Number of extensions: 21
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 250
Length of database: 596
Length adjustment: 30
Effective length of query: 220
Effective length of database: 566
Effective search space:   124520
Effective search space used:   124520
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory