Align TM0029, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate 8500163 DvMF_0921 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= TCDB::Q9WXN6 (280 letters) >FitnessBrowser__Miya:8500163 Length = 284 Score = 139 bits (350), Expect = 7e-38 Identities = 83/264 (31%), Positives = 144/264 (54%), Gaps = 8/264 (3%) Query: 18 GFSIFLFFLFLGIFGPMFYRVDPTEMTWD-YEQPPSSAHPLGTDTYGRDVLAQLLHGIRS 76 G S+ L + P DPT + QPPSSAHPLGTD GRDVL+++LHG R Sbjct: 25 GLSLVLAMSAAALLAPWIAPHDPTALNLTAILQPPSSAHPLGTDALGRDVLSRMLHGARV 84 Query: 77 SLYIGFLAAIISLVIGTIIGSFSAVKRGIVDDVLMGITNIVLTTPSILIAILIASYLKVR 136 SL++GF++ IS+ IG +G + G+ D+++M +I+L PS + + + ++L+ Sbjct: 85 SLWVGFVSVGISVAIGLALGLAAGYFGGLADELIMRCVDIMLCFPSFFLILAVIAFLEPS 144 Query: 137 SVEMVAVILGLFQWPWFARAIRAQLMSVMSREYVYLSVMAGYSDLRLVIEDLIPTIATYA 196 + ++AVI GL W AR +RA+ +S+ R+++ + +AG +R++ ++P Sbjct: 145 LLNIMAVI-GLTSWMGVARLVRAETLSLRERDFIAAARLAGAGPVRILCLHVLPNAVAPV 203 Query: 197 FMSFVLFINGGIMGEAGLSLIGLG--PTQGISLGIMLQWAVLMEAVRRGLWWWFVPPGLA 254 +S L + G I+ E+ LS +GLG P ++L+ ++E W V PG A Sbjct: 204 LVSATLGVAGAILTESALSFLGLGVQPPMPSWGNMLLEGKDVLEIAP----WLSVFPGCA 259 Query: 255 IVAVTASLLVISTAMDEVFNPRLR 278 I+ ++ ++ ++ +PRL+ Sbjct: 260 ILLTVLGYNLLGESLRDLLDPRLK 283 Lambda K H 0.330 0.144 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 284 Length adjustment: 26 Effective length of query: 254 Effective length of database: 258 Effective search space: 65532 Effective search space used: 65532 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory