Align TM0030, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate 8501683 DvMF_2401 nickel transporter permease NikB (RefSeq)
Query= TCDB::Q9WXN7 (338 letters) >FitnessBrowser__Miya:8501683 Length = 313 Score = 168 bits (426), Expect = 1e-46 Identities = 105/330 (31%), Positives = 175/330 (53%), Gaps = 23/330 (6%) Query: 9 YLLRRFIFLLVTYIVATTIVFILPRAIPGNPLSQILSGLSRVAQANPEAIRAAERTLMEE 68 Y+L+R L+ ++ + +VF+L RA G+P L LSR+ + EA+ A R L Sbjct: 4 YILKRLAALIPLLLLVSVVVFLLLRAAQGDPAMAYLR-LSRIPPTD-EALATARRMLE-- 59 Query: 69 FGLGKPWYVQYFEFITKALRGDLGTSITFYPRKVIDLIIPVIPWTLILLLPATIVAWILG 128 L P + QY ++ +A+ GD G S R V+ ++ +P TL L A ++ I+ Sbjct: 60 --LDLPLWEQYARWLARAVTGDFGNSYVT-GRPVLGEVLHYLPATLQLAGAALLLTLIVS 116 Query: 129 NSLGALAAYKRNTWIDKGVLTTSLIVSQIPYYWLGMIFIFLFGVKLGWLPVQGAYSQGTI 188 LG AA R+ +D S +P +WLG + ++LF VKLGWLP G Sbjct: 117 IPLGVGAALHRDRPLDNAARALSFTSVSLPNFWLGFLLVWLFAVKLGWLPALGRGG---- 172 Query: 189 PNLSWSFFVDVLKHYIMPFASIVVSAMGGWAIGMRLMVIYELGSDYAMFSEYLGMKDKRI 248 L+H ++P ++ + +MG +R ++ + + + M++ G+ ++ + Sbjct: 173 -----------LEHLVLPAVTLSLMSMGINTRLIRASLLENMHARHIMYARARGISERGV 221 Query: 249 -FKYVFRNSLLPQITGLALSLGGVLGGALITEIVFNYPGTGYLLFRALTTLDYPLIQGIF 307 ++++F+NSL+P +T L + +G +LGGA+I E VF +PG G A+ DYP++Q Sbjct: 222 VWRHMFKNSLIPVLTSLGMHVGELLGGAVIVETVFAWPGVGRYAVSAVYNRDYPILQCFM 281 Query: 308 VILIASIYLANFIVDFLYALIDPRIRLGQE 337 +++ A L N VD LYA DPRIRLG++ Sbjct: 282 LLMTAIFVLCNLAVDILYAWADPRIRLGED 311 Lambda K H 0.329 0.146 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 313 Length adjustment: 28 Effective length of query: 310 Effective length of database: 285 Effective search space: 88350 Effective search space used: 88350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory