Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate 8501089 DvMF_1825 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__Miya:8501089 Length = 339 Score = 177 bits (449), Expect = 3e-49 Identities = 107/305 (35%), Positives = 168/305 (55%), Gaps = 22/305 (7%) Query: 21 KKRKFYALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVGLQKPTSGEVVYDGYNIWKNK 80 K+ +A+ DVS + G+ L V+GESG GK+TL R ++GL + T GE++Y G I Sbjct: 38 KRTVVHAVNDVSFDILPGETLSVVGESGCGKSTLARTVIGLYRATGGEILYRGERIDNLS 97 Query: 81 RKIFKKYRKDVQLIPQDPYSTLPFNKTVEEILVAPILRWEK--INKDELRKRLINLLELV 138 YR +Q++ QDPY++L V EIL P+ R+ I+ ++R R+ +++E V Sbjct: 98 DNGMLPYRTRMQMVFQDPYASLNPRMKVREILEEPV-RFHNPGISDADVRARVADVMEQV 156 Query: 139 KLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEPVTMVDASLRIGILNTLAE 198 + P +YPH+ SGGQ+QR+SIAR+L V+P IVADEP++ +D S++ +LN + + Sbjct: 157 GVNPLWGV--RYPHEFSGGQRQRISIARALVVDPEFIVADEPISALDVSIQAQVLNLMMD 214 Query: 199 IKNRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRIVERADLEEILKDPLHPYTNDL 258 ++ + NLT +FI+HD+ + + VM+ G + E A E++ +P HPYT L Sbjct: 215 MQEKRNLTYLFISHDLSVVEHI-----STRVAVMYLGSLCELASAEDLFGNPRHPYTRAL 269 Query: 259 IKLTPSID-------NLYKEINVKINYERVEKGCPYRLRCPFAMDICKNEEPKL--FKYS 309 + P I L ++ IN + GC + RC A C E PK + Sbjct: 270 LSAIPRIGGKAAGHIKLSGDVPTPIN---LPTGCVFHGRCQHANARCMQEVPKARQLEGG 326 Query: 310 HEVAC 314 +VAC Sbjct: 327 AQVAC 331 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 339 Length adjustment: 28 Effective length of query: 296 Effective length of database: 311 Effective search space: 92056 Effective search space used: 92056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory