Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate 8500851 DvMF_1589 ABC transporter related (RefSeq)
Query= TCDB::P96483 (377 letters) >FitnessBrowser__Miya:8500851 Length = 354 Score = 218 bits (554), Expect = 3e-61 Identities = 132/335 (39%), Positives = 190/335 (56%), Gaps = 35/335 (10%) Query: 20 AVDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGGAIRIGDRDVT------HLP 73 AVD L++ I GE ++GPSGCGK+T+LRM+AG ED++ G I +GDR ++ +LP Sbjct: 18 AVDSLNLEIGRGECFSMLGPSGCGKTTTLRMVAGFEDLDDGEIHVGDRLLSARRNNYYLP 77 Query: 74 PKDRDIAMVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAAKILDLTQYLDRKP 133 P+ RD MVFQ +A++PH++V +N+ F L+I + AEI ++ EA L + P Sbjct: 78 PEKRDFGMVFQAFAVWPHLSVYENVAFPLRIRRLSAAEIDRRTREALHHTSLADVAQKSP 137 Query: 134 KALSGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIASLQRRLGITTVYVT 193 LSGG +QRVA+ RA+ P V L+DEPLS+LD LR R +I LQR G + +YVT Sbjct: 138 DDLSGGGKQRVALARALAINPDVMLLDEPLSSLDPHLREEMRFEIKDLQRTFGFSILYVT 197 Query: 194 HDQVEAMTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGSPAMNLVEVPITDGGV 253 HDQ EAM + DR+ V+++G++QQV +P ++Y PAN FV GFIG N ++V +T Sbjct: 198 HDQSEAMALSDRIMVMRNGVVQQVGTPLDVYTNPANSFVFGFIG--LSNFLDVNLTP--- 252 Query: 254 KFGNSVVPVNREALSAADKGDRTVTVGVRPEHFDVVELGGAVAASLSKDSADAPAGLAVS 313 E L + GD VT P +V G A AS + Sbjct: 253 -----------EGLVRVNGGDARVTPAT-PPSARLVSAGRAALASRPSE----------- 289 Query: 314 VNVVEELGADGYVYGTAEVGGEVKDLVVRVNGRQV 348 ++ E G G V A + GE+ D + V+G++V Sbjct: 290 IDFTAEGGLRGVVRRRAYL-GEIVDYRIDVSGQEV 323 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 354 Length adjustment: 30 Effective length of query: 347 Effective length of database: 324 Effective search space: 112428 Effective search space used: 112428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory