Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate 8500756 DvMF_1497 transport system permease protein (RefSeq)
Query= CharProtDB::CH_004160 (318 letters) >FitnessBrowser__Miya:8500756 Length = 387 Score = 173 bits (439), Expect = 5e-48 Identities = 113/295 (38%), Positives = 158/295 (53%), Gaps = 21/295 (7%) Query: 43 HYYVLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLL 102 H V+ RL R+ LAL G LAVAG + QG++RNPLA P LGV+ A+ + AL L Sbjct: 80 HMLVVTRIRLARVCLALLAGGGLAVAGTVFQGVLRNPLADPFTLGVSGGAAFGASLALTL 139 Query: 103 ------------MPSL----PVMVLPLLAFAGGMAGLILLKMLAKT----HQPMKLALTG 142 +P+ P +LPL A AG +A L + +L + + L G Sbjct: 140 GIGPLAAWLTMHLPAFAALSPQALLPLAALAGALASLGAVLLLGGAAGGGFRRETVVLAG 199 Query: 143 VALSACWASLTDYLMLSRPQDVNNALLWLTGSLWGRDWSFVKIAIPLMILFLPLSLSFCR 202 V +S ++L + + V++ + W+ GSL GR W+ + +P + L L L L R Sbjct: 200 VVVSTVLSALVSLVKALDEESVSSIVFWIMGSLQGRGWAHAAVLLPWLALGLLLVLPRFR 259 Query: 203 DLDLLALGDARATTLGVSVPHTRFWALLLAVAMTSTGVAACGPISFIGLVVPHMMRSITG 262 +LD+LALGD +A LG+ R L+ A +T+ VA G I F+GLVVPH+ R G Sbjct: 260 ELDILALGDVQARQLGMDTARVRLQLLVGASLITAGCVAVSGVIGFVGLVVPHLARMRLG 319 Query: 263 GRHRRLLPVSALTGALLLVVADLLARIIHP-PLELPVGVLTAIIGAPWFVWLLVR 316 H LL G +LL AD+LAR + P ELPVGV+TA++G P+F LLVR Sbjct: 320 AAHGPLLAAGWFGGGVLLAWADVLARTLLPGGAELPVGVVTALLGGPFFCLLLVR 374 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 387 Length adjustment: 29 Effective length of query: 289 Effective length of database: 358 Effective search space: 103462 Effective search space used: 103462 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory