Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate 8499832 DvMF_0597 phosphonate ABC transporter, ATPase subunit (RefSeq)
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__Miya:8499832 Length = 270 Score = 123 bits (308), Expect = 4e-33 Identities = 83/246 (33%), Positives = 129/246 (52%), Gaps = 10/246 (4%) Query: 2 TLRTENLTVSYGTDK-VLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVF 60 +L ENL Y K VL +++L++ TA+IGP+G GKSTLL C +RL+ P SG + Sbjct: 22 SLVVENLRKEYTRGKPVLKNINLTVAGQCTTAIIGPSGTGKSTLLRCINRLIEPTSGRIL 81 Query: 61 LGDNPINMLSSRQLA---RRLSLLPQHHLTPEGITVQELVSYGR----NPWLSLWGRLSA 113 + I L L RR+ ++ Q + E ++V E V GR +PW + + Sbjct: 82 VSGQDICTLRGSDLRAARRRIGMVFQEYNLVERLSVMENVLCGRLGYISPWRAWLRKFPQ 141 Query: 114 EDNARVNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINH 173 ED R ++ + A R ELSGGQRQR +A + Q ++L DEPT+ LD Sbjct: 142 EDIERAYDLLDMVGLTEFARARADELSGGQRQRVGIARAVMQQPHILLADEPTSSLDPKT 201 Query: 174 QVDLMRLMGELRTQGKTVVAV-LHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLR 232 V++M L+ E+ + V V +HD+ R+ D++V M+ G V+ G P + +T L+ Sbjct: 202 SVEIMELLREVASVNDIPVLVNIHDVTLGRRFADRVVGMSKGDVVFDGVPGD-LTDEHLK 260 Query: 233 TVFSVE 238 ++ E Sbjct: 261 LIYGGE 266 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 270 Length adjustment: 25 Effective length of query: 230 Effective length of database: 245 Effective search space: 56350 Effective search space used: 56350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory