Align isocitrate dehydrogenase (NAD+) (EC 1.1.1.41) (characterized)
to candidate 8501002 DvMF_1739 isocitrate/isopropylmalate dehydrogenase (RefSeq)
Query= BRENDA::Q8GAX0 (429 letters) >FitnessBrowser__Miya:8501002 Length = 382 Score = 423 bits (1088), Expect = e-123 Identities = 217/391 (55%), Positives = 275/391 (70%), Gaps = 23/391 (5%) Query: 31 FIEGDGIGCDVTPAMRSVVDAAVAKVYGGQRQIAWMELFAGQKAVQLYGEGQYLPDETMA 90 +IEGDGIG DV A R V+DAAVAK YG R I W EL AG+KA GE YLP+ TM Sbjct: 7 WIEGDGIGPDVWKAARPVIDAAVAKTYGDARSIEWKELLAGEKAYAATGE--YLPEATMQ 64 Query: 91 AIREYKVAIKGPLETPVGGGIRSLNVAMRQDLDLYVCLRPVRYFEGTPSPMRHPEKVDMV 150 A+R ++AIKGPL TPVG G RSLNV +RQ LDLY C+RP+RYFEG SP++ P+ VDMV Sbjct: 65 ALRGAELAIKGPLGTPVGKGFRSLNVTLRQTLDLYACIRPIRYFEGIMSPVKRPDLVDMV 124 Query: 151 IFRENSEDIYAGIEWPAGSPEAEKIIRFLREEMGVTKIRFPDSSAIGIKPVSTEGSERLI 210 +FREN+ED+YAGIE+ AG+PEA+++I FLR E+G SA+GIKP++ GS+RL+ Sbjct: 125 VFRENTEDVYAGIEYKAGTPEAKRLIDFLRNELGAN---VDPESAVGIKPMTARGSKRLV 181 Query: 211 RRTIQYALEHGKPSVSLVHKGNIMKFTEGGFRDWGYALAEREFAGRVFTWRQKAAISKAE 270 RR + +A+ + S++LVHKGNIMKFTEGGFR+WGY + EFA AA+ +A+ Sbjct: 182 RRAMDFAVAQKRSSLTLVHKGNIMKFTEGGFREWGYEVVRDEFAD--------AAVLEAD 233 Query: 271 GKAAGQKAEQQAIADGKLIIKDVIADNFLQQILLRPEDYSVVATLNLNGDYVSDALAAEV 330 A GK+++KD IAD Q++L+RP+ YSV+AT NLNGDY+SDALAA+V Sbjct: 234 AGGAA----------GKVVVKDRIADAMFQEVLIRPDQYSVIATSNLNGDYLSDALAAQV 283 Query: 331 GGIGMAPGANLSDTHAIFEATHGTAPDIAGQGKANPSSLILSAVMMLEHLGWGEAAQAIV 390 GG+G+APG N+SD+ A FEATHGTAP IAGQ KANP SLIL +MLEH+GW +AA I Sbjct: 284 GGLGLAPGVNMSDSLAFFEATHGTAPTIAGQDKANPGSLILCGALMLEHMGWNDAATRIY 343 Query: 391 AAMNATIAAGEVTGDLAALRGDVPALSTTEF 421 A+N TI VT DLA+ + T F Sbjct: 344 NAINTTIGKRTVTVDLASQMASATTVGTVAF 374 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 382 Length adjustment: 31 Effective length of query: 398 Effective length of database: 351 Effective search space: 139698 Effective search space used: 139698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory