Align Tricarboxylic transport TctA (characterized, see rationale)
to candidate 8501266 DvMF_1999 protein of unknown function DUF112 transmembrane (RefSeq)
Query= uniprot:E4PJQ9 (508 letters) >FitnessBrowser__Miya:8501266 Length = 514 Score = 307 bits (787), Expect = 5e-88 Identities = 173/498 (34%), Positives = 286/498 (57%), Gaps = 8/498 (1%) Query: 17 PYNLMFALFGAFVGTLIGCLPGLGPANGVAILIPLAFTLGLPPETAMILLTAVYAGAMYG 76 P N++ + G G ++G LPGL GVA+++P F + + +I+L A+YAGA+YG Sbjct: 15 PLNILLMVVGLTGGIIVGALPGLTATMGVALMVPATFAMDAT--SGLIMLGAIYAGAIYG 72 Query: 77 GRISSILLNIPGDEPAMMTCLDGYPMAQKGRAADALAVSAIASFAGGLIGTIGLIMLAPV 136 G S+ L+ PG ++ T DG+P+ Q GRA L S ++S GG++GT+ L+ LA Sbjct: 73 GANSACLICTPGTPSSVATTFDGWPLCQAGRADIGLVTSLLSSAFGGIVGTVLLLFLAAP 132 Query: 137 LAKFALTFGPAEYFALFLLAFATLGGITGKNPVKTVVAATLGIMISTVGIDISTGTQRYT 196 LA+FAL FG E F L + +T+ ++ N VK +++ +G+++STVGID + G R+T Sbjct: 133 LARFALQFGGPENFWLCIFGLSTIAVMSSGNMVKGLLSGAMGLLVSTVGIDPNAGVPRFT 192 Query: 197 FGVLELYEGIDFILAIVGLFAISELLFFVES-RMGRGRDKMNVGKLTLTMKELVMTIPT- 254 FG L +GI+ I A++GLF+ S++L+ + S + + G L ++ LV Sbjct: 193 FGYYPLVQGIEVIPAMIGLFSFSQVLYLIGSYKPFIAEYQPTPGALGHVVRALVSRCKVI 252 Query: 255 QLRGGVLGFISGVLPGAGASLGSFISYTLEKQVVGKKGKFGEGDIRGVVAPEAGNNGASS 314 LR ++G + G+LPGAG + S I+Y K+ K+G+G + G+ + E+ NN Sbjct: 253 LLRSSLIGGLVGMLPGAGGEIASIIAYNESKRWDKDPSKYGKGAVEGLASSESANNAVIG 312 Query: 315 GALVPMLTLGVPGSGTTAVLLAMLISLNITPGPLMFTQNADIVWGVIAALLIGNVLLLVL 374 G+L+PMLTLG+PGS AV+L L++ I PG +FT D+ + I + N+L++ + Sbjct: 313 GSLIPMLTLGIPGSAVAAVILGALLAKGIQPGFKVFTTTGDLAYTFIMSQFAVNLLMIPV 372 Query: 375 NIPLVGFFVKLLSVPPMYLLPIVTMVAFVGIYSISHSTFDLYFMVAFGVAGYFLRKLEIP 434 + L KLLSV ++ + +++ +G Y+I +S D++ ++AFG GYF ++ + Sbjct: 373 GLLLARVMTKLLSVRLTFVAIAIVVLSVIGSYAIRNSMLDVWIVIAFGFLGYFSGRVGLD 432 Query: 435 LVPIILGLLLGPEMEKNLGHALVLSDGEW----SVLWASPLAMGLWIVAGLGLILPYLVG 490 + LG++LGP +E+NLG + LS +V SP+A+ L+++ L L P+L+ Sbjct: 433 TGAMALGIILGPMIEENLGKCVHLSRASGGSVINVFLESPIAILLFLMTMLSLATPFLLD 492 Query: 491 PLLRRRMNAAMKESPVSD 508 +RR E P D Sbjct: 493 WKRKRRDCGCDTEQPKED 510 Lambda K H 0.325 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 755 Number of extensions: 45 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 508 Length of database: 514 Length adjustment: 35 Effective length of query: 473 Effective length of database: 479 Effective search space: 226567 Effective search space used: 226567 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory