Align isobutanoate/2-methylbutanoate--CoA ligase (EC 6.2.1.1) (characterized)
to candidate 8501639 DvMF_2357 AMP-binding domain protein (RefSeq)
Query= metacyc::MONOMER-20125 (556 letters) >FitnessBrowser__Miya:8501639 Length = 550 Score = 175 bits (443), Expect = 5e-48 Identities = 166/565 (29%), Positives = 252/565 (44%), Gaps = 81/565 (14%) Query: 20 LERAATVYGDCTSVVYDAVSYTWSQTHRRCLC----LASSIASLGIENGHVVSVLAPNVP 75 L+ Y D +V+Y V + QT+R+ LA + +LG+ +G V+V A NVP Sbjct: 15 LDETVAKYPDNDAVIY--VDRDYRQTYRQFSQVVDDLAKGLMALGVRHGEKVAVWATNVP 72 Query: 76 QMYELHFAVPMAGAILNAVNLRLDARTISILLHHSESKLIFV-----DHLSRDLILEAIA 130 L FA GAIL VN I LL SE + +F+ DH D + Sbjct: 73 YWVALQFATAKMGAILLTVNTNYREHEIRYLLTQSECENLFIIDGFRDH---DYVQTIYN 129 Query: 131 LFPKQAPVPR-------------LVFMADESESGNSSE---LGKEFFCSYKDLIDRG--- 171 + P+ PR ++F+ E G S + S ++ +R Sbjct: 130 MIPELKTQPRGQLRCSSLPHLKRVMFLGAEKHRGMYSVPEIISMSAMVSDEEYAERQRAL 189 Query: 172 DPDFKWVMPKSEWDPMILNYTSGTTSSPKGVVHCH-----RGIFIMTVDSLIDWGVPKQP 226 DP D + + YTSGTT PKGV+ H G +I + K Sbjct: 190 DPH----------DVVNMQYTSGTTGFPKGVMLTHVNIGNNGYWIGKNQHFTE----KDR 235 Query: 227 VYLWTLPMFHANGWSYPWGMAAV--GGTNICLRKFDSEIIYDMIKRHGVTHMCGAP---- 280 V L +P+FH G +AA+ G + L F + + + T + G P Sbjct: 236 VCL-PVPLFHCFGCVLGV-LAAINHGAALVILESFSPMHVMASVDQEKCTALYGVPTMFL 293 Query: 281 -VVLNMLSNAPGSEPLKTTVQIMTAGAPPPSAVLFRTESLGFA--VSHGYGLTETAGLVV 337 V+ + L L+T + AG+ P ++ R + ++ YGLTE + ++ Sbjct: 294 AVLEHKLFERFDFSSLRTGIM---AGSVCPEPLMRRVVEKMYMREITICYGLTEGSPVMT 350 Query: 338 SCAWKKEWNHLPATERARLKSRQGVGTVMQT-KIDVVDPVTGAAVKRDGSTLGEVVLRGG 396 + + Q VG M ++ +VDP T V R T GEVV RG Sbjct: 351 QSLVTDPFE----------RRVQTVGRAMPCIEVRIVDPDTNEEVPR--GTQGEVVCRGY 398 Query: 397 SVMLGYLKDPEGTAKSMTADGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVE 456 +VM GY PE T ++ ADGW ++GD+GVM +GY+ I R KD+II GGEN+ E+E Sbjct: 399 NVMKGYYNMPEATTAAIDADGWLHSGDLGVMDEEGYVVITGRIKDMIIRGGENIYPREIE 458 Query: 457 SILYSHPDILEAAVVARPDEFWGETPCAFVSLKKGLTKKPTEKEIVEYCRSKLPRYMVPK 516 LY + + VV +GE AF+ K G+ P +++ +YCR ++ + VP+ Sbjct: 459 EFLYGMDGVQDVQVVGVNSRKYGEEVGAFIIPKPGVEMAP--EDVRDYCRGRIAWHKVPR 516 Query: 517 TVVFKEELPKTSTGKVQKFILRDMA 541 + F + P T++GK+QKF LR+MA Sbjct: 517 YISFIDAYPMTASGKIQKFKLREMA 541 Lambda K H 0.319 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 703 Number of extensions: 36 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 556 Length of database: 550 Length adjustment: 36 Effective length of query: 520 Effective length of database: 514 Effective search space: 267280 Effective search space used: 267280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory