Align purine-nucleoside phosphorylase (EC 2.4.2.1) (characterized)
to candidate 8500058 DvMF_0821 purine nucleoside phosphorylase (RefSeq)
Query= BRENDA::P00491 (289 letters) >FitnessBrowser__Miya:8500058 Length = 281 Score = 236 bits (602), Expect = 4e-67 Identities = 125/259 (48%), Positives = 169/259 (65%), Gaps = 7/259 (2%) Query: 24 RPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQG 83 RP+V ++CG+GLGGL D L A+ Y +P FP+STV H GR +FG + V+ QG Sbjct: 30 RPRVGVVCGTGLGGLADALADARPLPYSRVPGFPQSTVASHEGRFLFGRIGTVEVVLQQG 89 Query: 84 RFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG 143 R H+YEGY V VRV LGV+ LV+TNAAG LNP+++ GD+MLI DHIN F+G Sbjct: 90 RCHLYEGYAPEDVCMGVRVMAALGVEMLVITNAAGALNPRWDAGDLMLITDHIN---FTG 146 Query: 144 QNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETV 203 ++PL GPN + +G RFP MS YD T+ + A+ ++G + L+ G YV V GP ET Sbjct: 147 RSPLTGPNHDAWGPRFPDMSAPYDATLGRIAMEEAARLGVR--LERGVYVGVPGPQMETP 204 Query: 204 AECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAA 263 AE R+ ++LGADAVGMSTV EVI ARH GLRV G S +TNK + D +++A EEV+ Sbjct: 205 AETRMYRQLGADAVGMSTVLEVIAARHMGLRVLGISCLTNKNLPD--CMQEAPLEEVIRV 262 Query: 264 GKQAAQKLEQFVSILMASI 282 +A KL + V+ ++ + Sbjct: 263 AGEAGDKLTRLVAAVVERV 281 Lambda K H 0.321 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 281 Length adjustment: 26 Effective length of query: 263 Effective length of database: 255 Effective search space: 67065 Effective search space used: 67065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate 8500058 DvMF_0821 (purine nucleoside phosphorylase (RefSeq))
to HMM TIGR01700 (purine nucleoside phosphorylase I, inosine and guanosine-specific (EC 2.4.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01700.hmm # target sequence database: /tmp/gapView.8639.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01700 [M=249] Accession: TIGR01700 Description: PNPH: purine nucleoside phosphorylase I, inosine and guanosine-specific Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-96 308.4 0.0 2.1e-96 308.1 0.0 1.0 1 lcl|FitnessBrowser__Miya:8500058 DvMF_0821 purine nucleoside phos Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8500058 DvMF_0821 purine nucleoside phosphorylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 308.1 0.0 2.1e-96 2.1e-96 2 248 .. 33 278 .. 32 279 .. 0.97 Alignments for each domain: == domain 1 score: 308.1 bits; conditional E-value: 2.1e-96 TIGR01700 2 iaiilGsGlGelaekvedavildyseiPefpestveGhkGklvfGklegkkvvilqGrfhlyegydlakvtfPvrvl 78 +++++G+GlG la+ + da l+ys +P fp+stv h+G+++fG+++ ++vv+ qGr hlyegy + v++ vrv+ lcl|FitnessBrowser__Miya:8500058 33 VGVVCGTGLGGLADALADARPLPYSRVPGFPQSTVASHEGRFLFGRIGTVEVVLQQGRCHLYEGYAPEDVCMGVRVM 109 89*************************************************************************** PP TIGR01700 79 kllGvealvvtnaaGgintefkvGdlmlikdhinllalnPliGpneekfGarfpdmsdaydkelrqkakeiakeldi 155 +lGve+lv+tnaaG++n+ + +Gdlmli+dhin+ +++Pl Gpn++ G+rfpdms yd l + a e a +l++ lcl|FitnessBrowser__Miya:8500058 110 AALGVEMLVITNAAGALNPRWDAGDLMLITDHINFTGRSPLTGPNHDAWGPRFPDMSAPYDATLGRIAMEEAARLGV 186 ***************************************************************************** PP TIGR01700 156 tlkeGvyvavtGPsyetpaevrllkklGadavGmstvpevivarhcGlrvlglslitnkaagildaelsdheevlev 232 +l++Gvyv+v GP+ etpae+r++++lGadavGmstv evi+arh Glrvlg+s++tnk +e+ eev++v lcl|FitnessBrowser__Miya:8500058 187 RLERGVYVGVPGPQMETPAETRMYRQLGADAVGMSTVLEVIAARHMGLRVLGISCLTNKNLPDCMQEAP-LEEVIRV 262 ***********************************************************9965555555.89***** PP TIGR01700 233 akkakekleklvsalv 248 a +a +kl++lv+a+v lcl|FitnessBrowser__Miya:8500058 263 AGEAGDKLTRLVAAVV 278 *************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (249 nodes) Target sequences: 1 (281 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.86 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory