GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupA in Desulfovibrio vulgaris Miyazaki F

Align RnsB, component of The (deoxy)ribonucleoside permease; probably takes up all deoxy- and ribonucleosides (cytidine, uridine, adenosine and toxic analogues, fluorocytidine and fluorouridine tested), but not ribose or nucleobases (characterized)
to candidate 8502321 DvMF_3029 ABC transporter related (RefSeq)

Query= TCDB::Q8DU37
         (510 letters)



>lcl|FitnessBrowser__Miya:8502321 DvMF_3029 ABC transporter related
           (RefSeq)
          Length = 537

 Score =  341 bits (874), Expect = 4e-98
 Identities = 195/498 (39%), Positives = 299/498 (60%), Gaps = 13/498 (2%)

Query: 5   VIEMREITKKFDDFVANDHINLDLRKGEIHALLGENGAGKSTLMNMLAGLLEPTSGSIKI 64
           V+ +  I K F    AN  I LD+R G I ALLGENGAGKSTLM++LAG L   +G+I +
Sbjct: 29  VVRLDGICKSFGKVRANHDITLDIRPGCIKALLGENGAGKSTLMSILAGKLRQDAGTIVV 88

Query: 65  NGSAVTIDSPSKSAQLGIGMVHQHFMLVEAFTVTENIILGNEVVKNGILDLKKAGQEIKA 124
           +G      SP  + + GIGMV+QHFMLV++ TV EN++LG     + +L   +   E+ A
Sbjct: 89  DGVPTVFASPRDALRAGIGMVYQHFMLVDSMTVAENVLLGQS--PDMLLRPARMRDEVAA 146

Query: 125 LSEKYGLAVDPNAKIADISVGAQQRVEILKTLYRGADILIFDEPTAVLTPSEIQELMTIM 184
           L+E+YGLAVDP A++  +S+G +QRVEILK LYR + +LI DEPTAVLTP E  +L   M
Sbjct: 147 LAERYGLAVDPAARVGGLSMGERQRVEILKLLYRDSRVLILDEPTAVLTPRETDQLFEAM 206

Query: 185 KSLVKEGKSIILITHKLDEIRSVADRVTVIRRGKSIETVEVSGTTSQD-LAEMMVGRSVS 243
             +  +GK+++ I+HKL E+ +VAD + ++RRG+ ++    +   +Q  LA  MVGR V 
Sbjct: 207 WRMADQGKALVFISHKLQEVLTVADEIAILRRGEVVDEFSEADVPNQTVLANRMVGRDVV 266

Query: 244 FTIEKTPTKPKETILSIKDLVVNENRGIPAIKGLSLEVKAGEIIGIAGIDGNGQSELVQA 303
             ++     P +T+LS+      E+     +  +SL+V+ GEI+ IAG+ GNGQ ELV+A
Sbjct: 267 LQVDAKRLTPVDTVLSV------EHLSGAGLSDVSLQVRRGEIVAIAGVAGNGQKELVEA 320

Query: 304 ITGLRKIKSGHLTIKGQDVTKLSTRKITELSVGHVPEDRHRDGLILELTMAENLALQTYY 363
           I GL + ++G + I G+   +          + ++PEDR        L + +N  L T  
Sbjct: 321 ICGLARPEAGEVRILGRPWREFFAGPPGRRGLAYIPEDRQGLATCRHLDLVDNFLLTT-- 378

Query: 364 KAPLSHNGVLNYSKINEHGRHLMQEFDVRGANELIPAKGFSGGNQQKAIIAREVDRDPDL 423
           +   +    L+ ++     + ++ E++V+  +   PA+  SGGN QK +I RE  R P++
Sbjct: 379 RNQFAKGVFLDRTEATNAVKRVVWEYNVQPGDITAPARALSGGNLQKLVIGREFFRKPEV 438

Query: 424 LIVSQPTRGLDVGAIEYIHKRLIAERDEGKAVLLVSFELDEILNLSDRIAVIHDGQIQGI 483
           ++   PT+GLD+ A E +  RL+  R     VLLV+ +L+E L L+DRIAV++ G+   +
Sbjct: 439 IVAENPTQGLDISATEEVWGRLLEARST-SGVLLVTGDLNEALELADRIAVMYRGRFIDV 497

Query: 484 VTPETTNK-QELGILMAG 500
              + T K Q +G++MAG
Sbjct: 498 FDKDDTAKVQAIGLMMAG 515


Lambda     K      H
   0.315    0.135    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 559
Number of extensions: 35
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 510
Length of database: 537
Length adjustment: 35
Effective length of query: 475
Effective length of database: 502
Effective search space:   238450
Effective search space used:   238450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory