Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate 8499484 DvMF_0256 AMP-dependent synthetase and ligase (RefSeq)
Query= reanno::acidovorax_3H11:Ac3H11_3009 (578 letters) >FitnessBrowser__Miya:8499484 Length = 583 Score = 205 bits (521), Expect = 5e-57 Identities = 122/356 (34%), Positives = 192/356 (53%), Gaps = 8/356 (2%) Query: 221 IQFTSGTTGFPKGATLTHRNILNNGFFIGECMKLTPADRLCIP--VPLYHCFGMVLGNLA 278 +Q+T GTTG KG LTH N+ N I + C +P +H +G+ Sbjct: 216 LQYTGGTTGISKGVMLTHHNMSVNVQQITTILGDARDMDHCFLGLMPYFHVYGLTTCLTL 275 Query: 279 CFTHGATIVYPNDGFDPLTVLQTVQDERCTGLHGVPTMFIAELDHPRFAEFNLSTLRTGI 338 ATIV P + P VL +Q + T G P+++I+ + +++L+++R I Sbjct: 276 PTALAATIV-PFPRYVPRDVLVGIQKHKPTIFPGAPSIYISLMQQKEVGDYDLTSIRYCI 334 Query: 339 MAGSPCPTEVMKRVVEQMNLREITIAYGMTETSPVSCQSSTDTPLSKRVSTVGQVQPHLE 398 +P P E +KR E + I +G+TE SPV+ + + ++G P E Sbjct: 335 SGSAPMPVEHIKRFRELTGAQVIE-GFGLTEASPVTHLNPIHGV--SKTGSIGIPFPDTE 391 Query: 399 VKIVDPDTGAV-VPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDEGGWMHTGDLATMDAE 457 +IVD + G V +P G+ GE +G VM GYW +T + GW++TGD+A MD + Sbjct: 392 ARIVDMEVGQVPLPAGKVGELIIRGPQVMKGYWNRPDETANTL-RNGWLYTGDIAIMDED 450 Query: 458 GYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPDQKYGEELCAWIIAKP 517 GY IV R KDM + GG N+YPREI+E L+ HP++++ VGVP GE + A+++ KP Sbjct: 451 GYFTIVDRKKDMFLVGGYNVYPREIDEVLHEHPKIKEAVTVGVPHPTRGEMIKAFVVVKP 510 Query: 518 GTQPTEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKIRDEMKDQLGLE 573 G + T+ ++ A C+ ++A YKVP+ + F P TV GK+ + +R E +++L E Sbjct: 511 GEKLTKAEVVAHCREKLASYKVPKQVEFRDDLPKTVVGKVLRRILRTEEEEKLKAE 566 Score = 44.7 bits (104), Expect = 1e-08 Identities = 27/95 (28%), Positives = 49/95 (51%), Gaps = 2/95 (2%) Query: 41 RQPEREALVSVHQGRRYTYAQLQTEAHRLASALLGMGLTPGDRVGIWSHNNAEWVLMQLA 100 R P R A+ + R +YA+L+ A +A+ L G+ GD+V I N + V+ A Sbjct: 41 RTPRRTAIA--FRNYRISYAKLRQLAEVMAANLRAQGVRRGDKVSIMLPNLPQTVIAFWA 98 Query: 101 TAQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSM 135 + G V+V NP Y E+ + ++ G + ++++ Sbjct: 99 VLKAGGVVVMTNPLYMEKELVHQIHDSGARFMIAL 133 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 786 Number of extensions: 51 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 578 Length of database: 583 Length adjustment: 36 Effective length of query: 542 Effective length of database: 547 Effective search space: 296474 Effective search space used: 296474 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory