Align acetate kinase (EC 2.7.2.1) (characterized)
to candidate 8501129 DvMF_1865 acetate kinase (RefSeq)
Query= BRENDA::Q9WYB1 (403 letters) >FitnessBrowser__Miya:8501129 Length = 404 Score = 422 bits (1085), Expect = e-123 Identities = 216/403 (53%), Positives = 283/403 (70%), Gaps = 8/403 (1%) Query: 1 MRVLVINSGSSSIKYQLIEMEGEKVLCKGIAERIGIEGSRLVHRV-----GDEKHVIERE 55 M VLVINSGSSSIKYQLI+M EK LC G+ ERIG +L H++ +EK V+E+ Sbjct: 1 MNVLVINSGSSSIKYQLIDMTTEKALCSGLVERIGEGMGKLTHKIKPDTDAEEKIVLEQA 60 Query: 56 LPDHEEALKLILNTLVDEKLGVIKDLKEIDAVGHRVVHGGERFKESVLVDEEVLKAIEEV 115 +H E +K +++ + D GVI D EI AVGHRV+ GGE K+SV +DE I + Sbjct: 61 FANHVEGMKKVVDLITDADKGVIADKGEIYAVGHRVLLGGEEIKQSVKIDEWAKGIIRDY 120 Query: 116 SPLAPLHNPANLMGIKAAMKLLPGVPNVAVFDTAFHQTIPQKAYLYAIPYEYYEKYKIRR 175 PL PLHNPANL GI+ A +L P P+V VFDT FHQT+P+KAYLY +PY+ Y+ +IRR Sbjct: 121 IPLGPLHNPANLAGIEVAEELFPHAPSVGVFDTEFHQTMPKKAYLYPLPYDLYKTLRIRR 180 Query: 176 YGFHGTSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTSMGFTPLEGL 235 YGFHGTSHRY++K+ AE LGK L+EL IITCH+GNG S+AAVK G+CVDT+MG TPLEGL Sbjct: 181 YGFHGTSHRYITKKTAEFLGKPLDELNIITCHLGNGCSMAAVKNGRCVDTTMGITPLEGL 240 Query: 236 VMGTRSGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFSSDMRDIEEAALKGD 295 +MGTR GD+DPA+ F+MEK+G S E+ ++NK+SG+ G+ +DMRDI A KGD Sbjct: 241 MMGTRCGDIDPALVPFLMEKKGWSGAEIDTVMNKQSGLKGICG--MNDMRDIHAAREKGD 298 Query: 296 EWCKLVLEIYDYRIAKYIGAYAAAMNGVDAIVFTAGVGENSPITREDVCSYLEFLGVKLD 355 E +L +++ YRI KYIG++A + +DAIVFTAG+GEN + R VC ++ LG+ +D Sbjct: 299 EMAELAFQMFVYRIRKYIGSFAVVVGKLDAIVFTAGIGENDDLVRAAVCKDMDILGIDID 358 Query: 356 KQKNEETIRGKEGIISTPDSRVKVLVVPTNEELMIARDTKEIV 398 + N + G+ I P RV VLVVPTNEEL IA+ T ++ Sbjct: 359 EAVNAKR-SGQARHIGKPGQRVPVLVVPTNEELEIAQTTVAVL 400 Lambda K H 0.318 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 498 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 404 Length adjustment: 31 Effective length of query: 372 Effective length of database: 373 Effective search space: 138756 Effective search space used: 138756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate 8501129 DvMF_1865 (acetate kinase (RefSeq))
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00016.hmm # target sequence database: /tmp/gapView.12671.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00016 [M=405] Accession: TIGR00016 Description: ackA: acetate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-148 480.9 0.0 1.6e-148 480.7 0.0 1.0 1 lcl|FitnessBrowser__Miya:8501129 DvMF_1865 acetate kinase (RefSeq Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8501129 DvMF_1865 acetate kinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 480.7 0.0 1.6e-148 1.6e-148 5 402 .. 2 398 .. 1 401 [. 0.95 Alignments for each domain: == domain 1 score: 480.7 bits; conditional E-value: 1.6e-148 TIGR00016 5 kilvlnaGssslkfalldaensekvllsglverikle..eariktv..edgekkeeeklaiedheeavkkllntlkk 77 +lv+n+Gsss+k++l+d++ +ek l+sglveri + + k++ +d+e+k ++a+++h e++kk+++ +++ lcl|FitnessBrowser__Miya:8501129 2 NVLVINSGSSSIKYQLIDMT-TEKALCSGLVERIGEGmgKLTHKIKpdTDAEEKIVLEQAFANHVEGMKKVVDLITD 77 79******************.69999*******97541133223333388899999999*****************9 PP TIGR00016 78 .dkkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavlklkvllkaknvavFD 153 dk ++ ++ ei ++GHRv Gge+ ++sv +++ + i+d ++l PlHnpa+l gie + + ++a+ v vFD lcl|FitnessBrowser__Miya:8501129 78 aDKGVIADKGEIYAVGHRVLLGGEEIKQSVKIDEWAKGIIRDYIPLGPLHNPANLAGIEVAE--ELFPHAPSVGVFD 152 999***********************************************************..7778899****** PP TIGR00016 154 tafHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddlnlivcHlGnGasvsavknGksid 230 t fHqt+p++aylY+lPy+lyk l +RrYGfHGtsh+y+t+++a+ l+kpld+ln+i+cHlGnG s++avknG+++d lcl|FitnessBrowser__Miya:8501129 153 TEFHQTMPKKAYLYPLPYDLYKTLRIRRYGFHGTSHRYITKKTAEFLGKPLDELNIITCHLGNGCSMAAVKNGRCVD 229 ***************************************************************************** PP TIGR00016 231 tsmGltPLeGlvmGtRsGdiDpaiisylaetlglsldeieetlnkksGllgisglssDlRdildkkeegneeaklAl 307 t+mG+tPLeGl+mGtR+GdiDpa++ +l+e++g s +ei +++nk+sGl gi g +D+Rdi ++ e+g+e a+lA+ lcl|FitnessBrowser__Miya:8501129 230 TTMGITPLEGLMMGTRCGDIDPALVPFLMEKKGWSGAEIDTVMNKQSGLKGICG-MNDMRDIHAAREKGDEMAELAF 305 ******************************************************.89******************** PP TIGR00016 308 kvyvhRiakyigkyiaslegelDaivFtgGiGenaaevrelvleklevlGlkldlelnnaarsgkesvisteeskvk 384 +++v+Ri+kyig+++ + g+lDaivFt+GiGen+ vr+ v++++++lG+++d++ n rsg+ + i ++ +v lcl|FitnessBrowser__Miya:8501129 306 QMFVYRIRKYIGSFAVVV-GKLDAIVFTAGIGENDDLVRAAVCKDMDILGIDIDEAVNA-KRSGQARHIGKPGQRVP 380 **************9999.66***********************************999.99*************** PP TIGR00016 385 vlviptneelviaeDalr 402 vlv+ptneel ia+ ++ lcl|FitnessBrowser__Miya:8501129 381 VLVVPTNEELEIAQTTVA 398 *************98876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (404 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.82 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory