Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate 8499632 DvMF_0398 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= SwissProt::Q8P3K4 (300 letters) >FitnessBrowser__Miya:8499632 Length = 267 Score = 86.7 bits (213), Expect = 5e-22 Identities = 80/248 (32%), Positives = 108/248 (43%), Gaps = 26/248 (10%) Query: 46 TVSIPTTPNTRLQGKRCLITAAGAGIGRESALACARAGAHVIATDIDAAALQALAAE-SD 104 T + P+T G C IT A AG G +A A G +IAT L AL E D Sbjct: 7 TTRATSAPSTSRGGIVC-ITGATAGFGAATARRFAAEGWRIIATGRRQDRLDALVTELGD 65 Query: 105 AITTQL-LDVTDAAAITA----LVAAHGPFDVLFNCAGYV------HQGSILDCDEPAWR 153 L DV D A+ A L A DVL N AG H+ S+ D W Sbjct: 66 GNCLPLCFDVRDGDAVQAALGNLPEAWRAVDVLVNNAGLALGLEPAHRCSMDD-----WM 120 Query: 154 RSFSINVDAMYYTCKAVLPGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSK 213 N+ + + +A+LPGM+ERGRG ++N+ S+ + P VYG TKA V+ S+ Sbjct: 121 TMVDTNIKGLLHVTRALLPGMVERGRGHVVNLGSITGTY-AYPGANVYGGTKAFVMQFSR 179 Query: 214 AIAADYVAQGVRCNAICPGTIKTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIA 273 + AD GVR I PG ++ V GGD V K + + P +IA Sbjct: 180 GLRADLHGTGVRVTNIEPGLAESEF---SVVRFGGDADRVAKLYEGASAL----RPEDIA 232 Query: 274 QLVVYLAS 281 + + S Sbjct: 233 DTIAWAVS 240 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 267 Length adjustment: 26 Effective length of query: 274 Effective length of database: 241 Effective search space: 66034 Effective search space used: 66034 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory