Align Lactaldehyde reductase (characterized, see rationale)
to candidate 8501604 DvMF_2322 bifunctional acetaldehyde-CoA/alcohol dehydrogenase (RefSeq)
Query= uniprot:Q8A199 (384 letters) >FitnessBrowser__Miya:8501604 Length = 904 Score = 232 bits (591), Expect = 4e-65 Identities = 145/388 (37%), Positives = 213/388 (54%), Gaps = 31/388 (7%) Query: 27 RGFKKAFFVTDKDLIKFGVAAEIIKVFDDNHIPYELYSDVKANPTIANVQNGVAAYKASG 86 R K+AF VTD+ + G ++ V + I + ++SDVK +P ++ + + +A Sbjct: 501 RDRKRAFIVTDRTMEDLGHVGKVTAVLEKLGIQFRVFSDVKPDPDLSGTYAALDSIRAFR 560 Query: 87 ADFIVALGGGSSIDTAKGIGIVVNNPD---------FADVKSLEGVADTKHKAVPTFALP 137 D +ALGGGS +D AK + ++ PD F D++ K A+P Sbjct: 561 PDMFIALGGGSPMDAAKIMWLMYEQPDLKFEEISLRFMDIRKRVHAFPALGKKAVMVAVP 620 Query: 138 TTAGTAAEVTINYVIIDEDARKKMVCVDPNDIPAVAIVDPELMYSMPKGLTAATGMDALT 197 TT+GT +EVT VI D+ K D P +AIVDPE + MPK LTA +G+DALT Sbjct: 621 TTSGTGSEVTPFAVITDDATGMKYPIADYELTPDMAIVDPEFVMDMPKTLTAHSGLDALT 680 Query: 198 HAIESYITPGAWAMSDMFELKAIEMIAQNLKAAVDNG-KDTVAREAMSQAQYIAGMGFSN 256 HA+E++ + A SD L+A+ ++ + L+ A ++G +D +ARE M A IAGM F+N Sbjct: 681 HAVEAFTSTYANNFSDGNALEAVRLVFKYLRRAYNDGARDVMAREKMHYAGTIAGMAFAN 740 Query: 257 VGLGIVHSMAHPLGAFYDTPHGVANALLLPYVMEYNA-ESPAAP-------------KYI 302 LG+ HSMAH LGA + PHG+ANALLL +V+EYNA ++P +Y Sbjct: 741 AFLGVCHSMAHKLGAAFHMPHGLANALLLSHVIEYNATDTPTKQGLMPQYRYPFVKGRYA 800 Query: 303 HIAKAMGVNTDGMTETEGVKAA--IEAVKALSLSIGIPQKLHEINVKEED----IPALAV 356 IA +G+ T+G + K A ++A++ L + +P L E + E D + LA Sbjct: 801 RIADMLGL-TEGCGDDRDRKVARLVQAIEQLKADLNVPGSLREAGIAEADFLERVDLLAE 859 Query: 357 AAFNDVCTGGNPRPTSVAEIEVLYRKAF 384 AF+D CTGGNPR +AEI LY KA+ Sbjct: 860 QAFDDQCTGGNPRYPLIAEIRELYLKAY 887 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 883 Number of extensions: 38 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 904 Length adjustment: 37 Effective length of query: 347 Effective length of database: 867 Effective search space: 300849 Effective search space used: 300849 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory