Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate 8500851 DvMF_1589 ABC transporter related (RefSeq)
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >FitnessBrowser__Miya:8500851 Length = 354 Score = 204 bits (518), Expect = 4e-57 Identities = 122/313 (38%), Positives = 175/313 (55%), Gaps = 14/313 (4%) Query: 1 MATLELRNVNKTYGPGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGG 60 M+ + L NV K +G + ++ L+I GE ++GPSGCGK+T + +AG E + G Sbjct: 1 MSYVRLVNVTKRFGG--VTAVDSLNLEIGRGECFSMLGPSGCGKTTTLRMVAGFEDLDDG 58 Query: 61 AILVDDADISG------MSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDE 114 I V D +S + P+ RD MVFQ++A++P +SV +N+AF L+IR++ AEID Sbjct: 59 EIHVGDRLLSARRNNYYLPPEKRDFGMVFQAFAVWPHLSVYENVAFPLRIRRLSAAEIDR 118 Query: 115 EVARVSKLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEM 174 + + + P LSGG +QRVA+ RALA P + L DEPLS+LD LR EM Sbjct: 119 RTREALHHTSLADVAQKSPDDLSGGGKQRVALARALAINPDVMLLDEPLSSLDPHLREEM 178 Query: 175 RTEMKLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVAS 234 R E+K + + + +YVTHDQ EAM L D++ VM++G++QQ GTP D+Y NPAN FV Sbjct: 179 RFEIKDLQRTFGFSILYVTHDQSEAMALSDRIMVMRNGVVQQVGTPLDVYTNPANSFVFG 238 Query: 235 FIGSPPMNFIPLRLQRKDGRLLALLDSGQARCELPLGMQDAGLEDREVILGIRPEQI-IL 293 FIG NF+ + L + L ++ G AR + L RP +I Sbjct: 239 FIGL--SNFLDVNLTPEG---LVRVNGGDARVTPATPPSARLVSAGRAALASRPSEIDFT 293 Query: 294 ANGEANGLPTIRA 306 A G G+ RA Sbjct: 294 AEGGLRGVVRRRA 306 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 354 Length adjustment: 30 Effective length of query: 356 Effective length of database: 324 Effective search space: 115344 Effective search space used: 115344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory