Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate 8499360 DvMF_0137 UDP-glucose 4-epimerase (RefSeq)
Query= curated2:Q9KDV3 (334 letters) >FitnessBrowser__Miya:8499360 Length = 356 Score = 317 bits (811), Expect = 4e-91 Identities = 166/348 (47%), Positives = 210/348 (60%), Gaps = 26/348 (7%) Query: 3 ILVTGGAGYIGSHTVLFLLEQGEQVIVLDNLQKGHAGALS----DVTFYHGDIRDDQLLD 58 +LV GGAGYIGSH V L+ +G ++ DNL GHA A+ D GD+ D Q L Sbjct: 9 VLVCGGAGYIGSHMVRALVARGCTPVIFDNLSTGHADAVDAAAPDCDLVRGDLLDRQTLR 68 Query: 59 TIFTTHSIDTVIHFAANSLVGESVKQPIEYYENNVIGTHTLLKKMLEHDVKKIVFSSTAA 118 +F HS D V+HF+A SLVGESV++P YY NNV GT LL M E V ++VFSSTAA Sbjct: 69 RVFAEHSFDAVMHFSARSLVGESVREPALYYANNVTGTLNLLDAMREAGVLRLVFSSTAA 128 Query: 119 TYGEPVQIPIQESDPTIPTNPYGETKLAIEKMFHWCQEAYGLQYVCLRYFNAAGADPNGR 178 YG PV I E+ P P NPYG +KL +E+M AYGL+ V LRYFNAAGAD G Sbjct: 129 VYGNPVTERIAETHPLAPVNPYGASKLMVERMLADHATAYGLRSVALRYFNAAGADRAGG 188 Query: 179 IGEDHSPESHLIPIVLQVALGQRERVAIFGDDYQTEDGSCIRDYIHVMDLANAHYLACEH 238 IGE HSPE+HLIP +L+ LG + +FG DY T DG+C+RDYIHV DL +AH A + Sbjct: 189 IGESHSPETHLIPNILRAVLGTGPALTVFGSDYDTPDGTCVRDYIHVNDLCDAHLAALDK 248 Query: 239 --------------LRKDGQSGS--------FNLGNGKGFSVKEVIEVCRQVTGHPIPAE 276 L KDG + +NLGNG GF+V++VI+ +VTG +P Sbjct: 249 LLAAPVGTAALKDGLTKDGLAAEPGGKVALHYNLGNGLGFTVRQVIDAAARVTGREVPYT 308 Query: 277 IAPRRSGDPASLIASSEKAQTILGWEPKYPSLETMVEHAWNWHKEHPH 324 + PRR GDPA L+A S A LGW PK + ++E AW WH++ + Sbjct: 309 VGPRRDGDPARLVADSTLAGRELGWTPKVADIREIIETAWAWHRDQKY 356 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 356 Length adjustment: 29 Effective length of query: 305 Effective length of database: 327 Effective search space: 99735 Effective search space used: 99735 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 8499360 DvMF_0137 (UDP-glucose 4-epimerase (RefSeq))
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.27024.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-128 413.0 0.0 4.1e-104 333.9 0.0 2.0 2 lcl|FitnessBrowser__Miya:8499360 DvMF_0137 UDP-glucose 4-epimeras Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8499360 DvMF_0137 UDP-glucose 4-epimerase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 333.9 0.0 4.1e-104 4.1e-104 1 247 [. 8 251 .. 8 265 .. 0.98 2 ! 77.4 0.0 4.5e-26 4.5e-26 253 328 .. 279 354 .. 266 356 .] 0.94 Alignments for each domain: == domain 1 score: 333.9 bits; conditional E-value: 4.1e-104 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleeekidaviHf 77 ++Lv GgaGyiGsh+vr+l ++g v++Dnls+g+++a+ a + lv+gdl d+++l++v++e+++dav+Hf lcl|FitnessBrowser__Miya:8499360 8 NVLVCGGAGYIGSHMVRALVARGCTPVIFDNLSTGHADAVDAAA--PDCDLVRGDLLDRQTLRRVFAEHSFDAVMHF 82 59***************************************998..69***************************** PP TIGR01179 78 aaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesplnpinpYGrsklmvEr 154 +a+ vgEsv+eP+ YY+nnv++tl+Ll+am++agv +l+Fss+aavYg++ + i E++pl+p+npYG+sklmvEr lcl|FitnessBrowser__Miya:8499360 83 SARSLVGESVREPALYYANNVTGTLNLLDAMREAGVLRLVFSSTAAVYGNPVTERIAETHPLAPVNPYGASKLMVER 159 ***************************************************************************** PP TIGR01179 155 ilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkrekleifGtdyptkDGtcvRDyiHv 231 +l d ++a ++l+ v+LRYFn+aGAd g iGe+++++thli+ ++++++g ++l++fG dy+t+DGtcvRDyiHv lcl|FitnessBrowser__Miya:8499360 160 MLADHATA-YGLRSVALRYFNAAGADRAGGIGESHSPETHLIPNILRAVLGTGPALTVFGSDYDTPDGTCVRDYIHV 235 ******99.******************************************************************** PP TIGR01179 232 eDlaeaHlaalealee 247 +Dl +aHlaal++l + lcl|FitnessBrowser__Miya:8499360 236 NDLCDAHLAALDKLLA 251 ************9976 PP == domain 2 score: 77.4 bits; conditional E-value: 4.5e-26 TIGR01179 253 vynlGagqgfsvkevieavkkvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekkl 328 ynlG+g gf v++vi+a+ +v+g+++++++ +rR+GDpa+lvad+ + relgw+pk d++eii++aw+W++ + lcl|FitnessBrowser__Miya:8499360 279 HYNLGNGLGFTVRQVIDAAARVTGREVPYTVGPRRDGDPARLVADSTLAGRELGWTPKVADIREIIETAWAWHRDQ 354 59**********************************************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (356 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 3.50 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory