Align ABC transporter for D-Glucosamine, periplasmic substrate-binding component (characterized)
to candidate 8500596 DvMF_1344 extracellular solute-binding protein family 3 (RefSeq)
Query= reanno::pseudo6_N2E2:Pf6N2E2_2053 (282 letters) >FitnessBrowser__Miya:8500596 Length = 272 Score = 90.5 bits (223), Expect = 4e-23 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 14/241 (5%) Query: 14 LFAATVAAVGVAQAADSKLDSVLQRGKLIVGTGSTNAPWHFQGADGKLQGFDIDIARMVA 73 L AA A + A S L+ ++ RG+L VG + P+ +G GFDID+A+ +A Sbjct: 15 LVAAPAMAADIELAKKSTLNEIMARGELRVGFDAGYMPFEMTDKNGNYVGFDIDLAKELA 74 Query: 74 KGLFNDPEKVEFVVQSS--DARIPNLLTDKVDMSCQFITVTASRAQQVAFTLPYYREGVG 131 K + V+FV ++ D IP LL+DK D+ +TVT R ++ F PY G Sbjct: 75 KAM-----GVKFVPVNTDFDGMIPALLSDKFDIIISGMTVTQERNLRINFANPYIVVGQS 129 Query: 132 LLLPA--NSKYKEIEDLKAAGDDVTVAVLQNVYAEELVHQALPKAKVDQYD-SVDLMYQA 188 +++ K K EDL + TV EE + LPKAK ++ D + Sbjct: 130 VIVSKKHEGKVKTWEDLNK--PEYTVVSRLGTTGEEAAKRMLPKAKYKSFEKEADGALEV 187 Query: 189 VNSGRADAAATDQS-SVKYLMVQNPGRYRSPAYAWSPQTYACAVKRGDQDWLNFVNTTLH 247 +N G+ADA D +V ++ Q G+ ++ + +K+GD D+LNF++ L Sbjct: 188 IN-GKADAWVYDMPFNVVFMAEQGKGKAIHLDKPFTYEPLGFGIKKGDPDFLNFLDNFLS 246 Query: 248 E 248 + Sbjct: 247 Q 247 Lambda K H 0.319 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 272 Length adjustment: 25 Effective length of query: 257 Effective length of database: 247 Effective search space: 63479 Effective search space used: 63479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory