Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate 8502075 DvMF_2788 ABC transporter related (RefSeq)
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >FitnessBrowser__Miya:8502075 Length = 243 Score = 224 bits (571), Expect = 1e-63 Identities = 118/247 (47%), Positives = 161/247 (65%), Gaps = 11/247 (4%) Query: 15 LLEIRDLHKQYGP-LEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIL 73 +++ +HK Y L VL+ + L +++G VV + G SGSGK+TL+RC+N LE Q G I+ Sbjct: 1 MIKFDHVHKWYASGLHVLQDITLEIKQGEVVVICGPSGSGKSTLIRCINKLEPIQKGHIV 60 Query: 74 LDGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLH 133 +DG I N + RA G FQQFNL+PH+T L+N+TL L V+ Sbjct: 61 VDGVDINDPRTN----------LTMLRAEVGFVFQQFNLYPHMTVLENITLAPLLVRNTP 110 Query: 134 KDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDP 193 + EA A + LE+V + ++ YPGQLSGGQQQRVAIAR +AM P +MLFDE TSALDP Sbjct: 111 RAEAEKTAMELLEKVNIPDKAGAYPGQLSGGQQQRVAIARGLAMKPRIMLFDEPTSALDP 170 Query: 194 ELVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQS 253 E++ EVL V++ LA +GMTM+ VTHEM FA EV+D+++FM+QG + E+ P+ F P Sbjct: 171 EMINEVLDVMRQLAREGMTMVCVTHEMGFAREVADRVIFMDQGVMVEENTPEAFFSNPVH 230 Query: 254 PRLAEFL 260 R EFL Sbjct: 231 DRTKEFL 237 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 243 Length adjustment: 24 Effective length of query: 241 Effective length of database: 219 Effective search space: 52779 Effective search space used: 52779 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory