Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate 8500137 DvMF_0900 Glucokinase (RefSeq)
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >FitnessBrowser__Miya:8500137 Length = 365 Score = 77.8 bits (190), Expect = 4e-19 Identities = 63/193 (32%), Positives = 81/193 (41%), Gaps = 5/193 (2%) Query: 124 PVEGKPIAVYGAGTGLGVAHLVHVDKRWVS---LPGEGGHVDFAPNSEEEAIILEILRAE 180 PV PIAV GAGTGLG L+ + LP EGGH F E E +RA Sbjct: 166 PVPDAPIAVVGAGTGLGKCLLLPASGDGMPPRVLPSEGGHALFPFTDEREMAFAAFVRAH 225 Query: 181 IGH-VSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCV 239 G V + V+SGPGL L A P + + T ADS + LS F Sbjct: 226 TGRQVIGDLVVSGPGL-RLLHAFHTGQWLEPAEVAARLATGAPGADSDLALPQVLSWFAR 284 Query: 240 IMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLI 299 GR + L GGVFI+GG+ F AF + + +PV L+ Sbjct: 285 FYGRACRDYVLETLALGGVFISGGVAAATPALVTHPAFAEAFRQSDTHADLLRAVPVRLV 344 Query: 300 VHDNPGLLGSGAH 312 + GLLG+ + Sbjct: 345 RSPDAGLLGAALY 357 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 321 Length of database: 365 Length adjustment: 29 Effective length of query: 292 Effective length of database: 336 Effective search space: 98112 Effective search space used: 98112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory