GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dctM in Desulfovibrio vulgaris Miyazaki F

Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate 8501197 DvMF_1931 TRAP dicarboxylate transporter, DctM subunit (RefSeq)

Query= uniprot:Q88NP0
         (426 letters)



>lcl|FitnessBrowser__Miya:8501197 DvMF_1931 TRAP dicarboxylate
           transporter, DctM subunit (RefSeq)
          Length = 640

 Score =  344 bits (882), Expect = 5e-99
 Identities = 180/423 (42%), Positives = 270/423 (63%), Gaps = 10/423 (2%)

Query: 4   FILLGSFIVLILIGMPVAYALGLSAL---IGAWWIDIPLQAMMIQVASGVNKFSLLAIPF 60
           ++L G F++ +L+G+P+A++LGL+ +   +GA  + +   A +  V+  ++ F +LAIPF
Sbjct: 222 WLLFGYFVLFLLVGVPIAFSLGLATIATVLGAGTLPLEYLAQIAFVS--IDSFPILAIPF 279

Query: 61  FVLAGAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSV 120
           F+ AG  M  GG+SRRL+A    LVG + GG++L  I+   FF AISGS  A  A++GS+
Sbjct: 280 FIAAGVFMGAGGLSRRLLALGDELVGALPGGMALATIVTCMFFAAISGSGPATVAAIGSI 339

Query: 121 LIPEMERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGL 180
            IP M  +GY + F+ AV  S     ++ PPS+  V+Y +AA    S+  LF+AGI+PG+
Sbjct: 340 TIPAMVERGYDKFFAAAVVASAGCIGVMIPPSNPFVVYGVAA--QASVGKLFLAGIVPGV 397

Query: 181 LLSAVMMGLCLIFAKKRNYPKGEVI--PLREALKIAGEALWGLMAMVIILGGILSGVFTA 238
           L    +M +    + K+ + +GE      R  ++   EA W L+  VI+LGGI  G+ T 
Sbjct: 398 LCGLALMAVAYYISLKKGW-RGEARHRDFRSVMQAMWEAKWALLVPVIVLGGIYGGIMTP 456

Query: 239 TESAAVAVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLMQI 298
           TE+AAV+ ++   V +FIYR+  WR +   M  + +T S++++L+  A  FG +MT+ Q+
Sbjct: 457 TEAAAVSALYGMIVGLFIYREITWRRMWDCMVESAQTSSVIIVLMAMATLFGNIMTIEQV 516

Query: 299 PSKITTAFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPVHF 358
           P  I    L ++ N+  IL+ IN  L+ +GT M+    I+I+TPILLP++T +GVDP+HF
Sbjct: 517 PDHIAAMILGVTSNKIAILLLINVFLLWVGTFMEALAAIVIITPILLPLVTQVGVDPIHF 576

Query: 359 GMIMLVNLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPAIS 418
           G+IM+VNL IG ITPPVG  LFV S+I KVSI   V+A  PF L +  +LMA+TYIPAIS
Sbjct: 577 GVIMVVNLAIGFITPPVGVNLFVASSISKVSIGDVVRAAWPFLLVMIALLMAITYIPAIS 636

Query: 419 LWL 421
           L L
Sbjct: 637 LCL 639


Lambda     K      H
   0.329    0.142    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 803
Number of extensions: 30
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 426
Length of database: 640
Length adjustment: 35
Effective length of query: 391
Effective length of database: 605
Effective search space:   236555
Effective search space used:   236555
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory