Align Solute-binding protein Bpro_3107 (characterized)
to candidate 8501198 DvMF_1932 TRAP dicarboxylate transporter, DctP subunit (RefSeq)
Query= SwissProt::Q128M1 (330 letters) >FitnessBrowser__Miya:8501198 Length = 335 Score = 123 bits (308), Expect = 7e-33 Identities = 97/331 (29%), Positives = 165/331 (49%), Gaps = 20/331 (6%) Query: 16 LAALLAGLGMGA-AQAT------EFRSADTHNADDYPTVAAVKYMGELLEKKSGGKHKIK 68 +AALL + + A QA +FR A T ++ T+A K+ +L+ +KSGGK ++ Sbjct: 8 VAALLMTVALAAPVQAAYDGPKIKFRLAHTTPPGNHITLAYQKF-ADLVAEKSGGKITVQ 66 Query: 69 VFNKQALGSEKETIDQVKIGALDFTRVNVGPMNAICPLTQVPTMPFLFSSI--AHMRKSL 126 VF LGS++ ++ + G L+ + + L V +P++ S ++ ++ Sbjct: 67 VFPNAILGSDRVLVEGAQKGTLEIGVSSTPNLANFSKLYSVFDLPYITSPKFQKNLYSAI 126 Query: 127 D--GPVGDEILKSCESAGFIGLAFYDSGARS-IYAKKPIRTVADAKGLKIRVQQSDLWVA 183 D G + D LK G + + + G R + K+P+ +D GLK+R S + V Sbjct: 127 DPGGTLYDYFLKVANDVGLQPIMYAEYGYRHFVSVKRPLGKASDLAGLKMRTTDSPVEVG 186 Query: 184 LVSAMGANATPMPYGEVYTGLKTGLIDAAENNIPSFDTAKHVEAVKVYSKTEHSMAPEIL 243 + A+ N +P+ +GEVYT L+ G IDA N P AKH E +K + H+ ++ Sbjct: 187 VAKALNTNPSPIAWGEVYTALQQGTIDAEGNTFPHLFGAKHHEVLKYAITSAHNYCMQVA 246 Query: 244 VMSKIIYDKLPKAEQDMIRAAAKESVAFERQ-KWDEQEAKSLANVKAAGAEI---VEVDK 299 + +K +D LP A + +I AAA+E+ ++R + E E + AG I + + Sbjct: 247 MANKAWWDGLPDAAKQVINAAAREATQYQRDVLYPENEKAAREGFIKAGITIHDATDAEI 306 Query: 300 KSFQAVMGPVYDKFMTTPDMKRLVKAVQDTK 330 F+ + PV+D +T P L+K VQDT+ Sbjct: 307 DEFRKLTRPVWDT-VTLP--AELIKLVQDTQ 334 Lambda K H 0.316 0.130 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 335 Length adjustment: 28 Effective length of query: 302 Effective length of database: 307 Effective search space: 92714 Effective search space used: 92714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory