Align 2-hydroxy-3-oxopropionate reductase; Tartronate semialdehyde reductase; TSAR; EC 1.1.1.60 (characterized)
to candidate 8502217 DvMF_2927 tartronate semialdehyde reductase (RefSeq)
Query= SwissProt::P0ABQ2 (294 letters) >lcl|FitnessBrowser__Miya:8502217 DvMF_2927 tartronate semialdehyde reductase (RefSeq) Length = 299 Score = 365 bits (936), Expect = e-106 Identities = 192/293 (65%), Positives = 222/293 (75%) Query: 2 KVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIADVIAAGAETASTAKAIAEQCDVII 61 ++GFIGLGIMG PM +NLLKAG+ + RN + + + A GA A + A+A DV+I Sbjct: 3 RIGFIGLGIMGAPMCRNLLKAGFPVTAYTRNGDKLRAMAAEGAAAAESPAAVAAASDVVI 62 Query: 62 TMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISEALKAKGIDMLDAPVS 121 TMLPNSP V+ VALG GI EGA PG ++ DMSSIAPLASREI+ L K I MLDAPVS Sbjct: 63 TMLPNSPEVRAVALGPGGIAEGAAPGCIVADMSSIAPLASREIAAELAKKSIRMLDAPVS 122 Query: 122 GGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGEIGAGNVTKLANQVIVALNI 181 GGEPKAIDGTLSVMVGG + FD + KAMA SVV GE+GAGNVTKLANQ++VA NI Sbjct: 123 GGEPKAIDGTLSVMVGGAQEDFDACLPVFKAMAASVVRVGEVGAGNVTKLANQIVVAGNI 182 Query: 182 AAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDLA 241 AAMSEAL LAT+AG +PDLVYQAIRGGLAGSTVLDAKAP+VMD F PGFRI LH KD+ Sbjct: 183 AAMSEALVLATRAGADPDLVYQAIRGGLAGSTVLDAKAPLVMDGRFTPGFRIRLHAKDMG 242 Query: 242 NALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSALACYYEKLAKVEVTR 294 N L+TS + LPL A +ME+MQ L ADGLG ADH AL ++EKLA VEV R Sbjct: 243 NVLETSRELHVPLPLAAQLMEVMQGLMADGLGDADHGALIRHWEKLAGVEVRR 295 Lambda K H 0.316 0.133 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 299 Length adjustment: 26 Effective length of query: 268 Effective length of database: 273 Effective search space: 73164 Effective search space used: 73164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate 8502217 DvMF_2927 (tartronate semialdehyde reductase (RefSeq))
to HMM TIGR01505 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01505.hmm # target sequence database: /tmp/gapView.8573.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01505 [M=291] Accession: TIGR01505 Description: tartro_sem_red: 2-hydroxy-3-oxopropionate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-122 393.2 9.1 3.8e-122 393.0 9.1 1.0 1 lcl|FitnessBrowser__Miya:8502217 DvMF_2927 tartronate semialdehyd Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8502217 DvMF_2927 tartronate semialdehyde reductase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 393.0 9.1 3.8e-122 3.8e-122 1 291 [] 3 293 .. 3 293 .. 0.99 Alignments for each domain: == domain 1 score: 393.0 bits; conditional E-value: 3.8e-122 TIGR01505 1 kvgfiGlGimGkPmsknllkaGyqlvvatleqealdellaaGaesaetakevvedadvivtmvPdsPqveevalGen 77 ++gfiGlGimG Pm++nllkaG+ +++ t++ ++l ++a Ga +ae+ ++v+ ++dv++tm+P+sP+v++valG+ lcl|FitnessBrowser__Miya:8502217 3 RIGFIGLGIMGAPMCRNLLKAGFPVTAYTRNGDKLRAMAAEGAAAAESPAAVAAASDVVITMLPNSPEVRAVALGPG 79 58*************************************************************************** PP TIGR01505 78 GileaakkGkvlvdmssiaPleskelakavkekGidvldaPvsGGeagaiegtlsimvGGdkavfdkvkpllealgk 154 Gi e+a +G ++ dmssiaPl+s+e+a ++ +k i++ldaPvsGGe++ai+gtls+mvGG + +fd p+++a++ lcl|FitnessBrowser__Miya:8502217 80 GIAEGAAPGCIVADMSSIAPLASREIAAELAKKSIRMLDAPVSGGEPKAIDGTLSVMVGGAQEDFDACLPVFKAMAA 156 ***************************************************************************** PP TIGR01505 155 sivlvGenGaGqtvkvanqvivalnieavsealvlaekaGvdpkavlqalrGGlagstvleakkerlldrdfkPGfr 231 s+v vGe GaG+++k+anq++va ni+a+sealvla++aG+dp++v+qa+rGGlagstvl+ak++ ++d f PGfr lcl|FitnessBrowser__Miya:8502217 157 SVVRVGEVGAGNVTKLANQIVVAGNIAAMSEALVLATRAGADPDLVYQAIRGGLAGSTVLDAKAPLVMDGRFTPGFR 233 ***************************************************************************** PP TIGR01505 232 idlhqkdlalaldaakavgaalPvtavvaellaalradGdgtldhsalvraleklakdkv 291 i lh kd++++l++++++ + lP++a +e+++ l adG g++dh al+r ekla+++v lcl|FitnessBrowser__Miya:8502217 234 IRLHAKDMGNVLETSRELHVPLPLAAQLMEVMQGLMADGLGDADHGALIRHWEKLAGVEV 293 ********************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (291 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.21 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory