Align 2-hydroxy-3-oxopropionate reductase; Tartronate semialdehyde reductase; TSAR; EC 1.1.1.60 (characterized)
to candidate 8502217 DvMF_2927 tartronate semialdehyde reductase (RefSeq)
Query= SwissProt::P0ABQ2 (294 letters) >FitnessBrowser__Miya:8502217 Length = 299 Score = 365 bits (936), Expect = e-106 Identities = 192/293 (65%), Positives = 222/293 (75%) Query: 2 KVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIADVIAAGAETASTAKAIAEQCDVII 61 ++GFIGLGIMG PM +NLLKAG+ + RN + + + A GA A + A+A DV+I Sbjct: 3 RIGFIGLGIMGAPMCRNLLKAGFPVTAYTRNGDKLRAMAAEGAAAAESPAAVAAASDVVI 62 Query: 62 TMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISEALKAKGIDMLDAPVS 121 TMLPNSP V+ VALG GI EGA PG ++ DMSSIAPLASREI+ L K I MLDAPVS Sbjct: 63 TMLPNSPEVRAVALGPGGIAEGAAPGCIVADMSSIAPLASREIAAELAKKSIRMLDAPVS 122 Query: 122 GGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGEIGAGNVTKLANQVIVALNI 181 GGEPKAIDGTLSVMVGG + FD + KAMA SVV GE+GAGNVTKLANQ++VA NI Sbjct: 123 GGEPKAIDGTLSVMVGGAQEDFDACLPVFKAMAASVVRVGEVGAGNVTKLANQIVVAGNI 182 Query: 182 AAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDLA 241 AAMSEAL LAT+AG +PDLVYQAIRGGLAGSTVLDAKAP+VMD F PGFRI LH KD+ Sbjct: 183 AAMSEALVLATRAGADPDLVYQAIRGGLAGSTVLDAKAPLVMDGRFTPGFRIRLHAKDMG 242 Query: 242 NALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSALACYYEKLAKVEVTR 294 N L+TS + LPL A +ME+MQ L ADGLG ADH AL ++EKLA VEV R Sbjct: 243 NVLETSRELHVPLPLAAQLMEVMQGLMADGLGDADHGALIRHWEKLAGVEVRR 295 Lambda K H 0.316 0.133 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 299 Length adjustment: 26 Effective length of query: 268 Effective length of database: 273 Effective search space: 73164 Effective search space used: 73164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate 8502217 DvMF_2927 (tartronate semialdehyde reductase (RefSeq))
to HMM TIGR01505 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01505.hmm # target sequence database: /tmp/gapView.1992047.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01505 [M=291] Accession: TIGR01505 Description: tartro_sem_red: 2-hydroxy-3-oxopropionate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-122 393.2 9.1 3.8e-122 393.0 9.1 1.0 1 lcl|FitnessBrowser__Miya:8502217 DvMF_2927 tartronate semialdehyd Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8502217 DvMF_2927 tartronate semialdehyde reductase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 393.0 9.1 3.8e-122 3.8e-122 1 291 [] 3 293 .. 3 293 .. 0.99 Alignments for each domain: == domain 1 score: 393.0 bits; conditional E-value: 3.8e-122 TIGR01505 1 kvgfiGlGimGkPmsknllkaGyqlvvatleqealdellaaGaesaetakevvedadvivtmvPdsPqveevalGen 77 ++gfiGlGimG Pm++nllkaG+ +++ t++ ++l ++a Ga +ae+ ++v+ ++dv++tm+P+sP+v++valG+ lcl|FitnessBrowser__Miya:8502217 3 RIGFIGLGIMGAPMCRNLLKAGFPVTAYTRNGDKLRAMAAEGAAAAESPAAVAAASDVVITMLPNSPEVRAVALGPG 79 58*************************************************************************** PP TIGR01505 78 GileaakkGkvlvdmssiaPleskelakavkekGidvldaPvsGGeagaiegtlsimvGGdkavfdkvkpllealgk 154 Gi e+a +G ++ dmssiaPl+s+e+a ++ +k i++ldaPvsGGe++ai+gtls+mvGG + +fd p+++a++ lcl|FitnessBrowser__Miya:8502217 80 GIAEGAAPGCIVADMSSIAPLASREIAAELAKKSIRMLDAPVSGGEPKAIDGTLSVMVGGAQEDFDACLPVFKAMAA 156 ***************************************************************************** PP TIGR01505 155 sivlvGenGaGqtvkvanqvivalnieavsealvlaekaGvdpkavlqalrGGlagstvleakkerlldrdfkPGfr 231 s+v vGe GaG+++k+anq++va ni+a+sealvla++aG+dp++v+qa+rGGlagstvl+ak++ ++d f PGfr lcl|FitnessBrowser__Miya:8502217 157 SVVRVGEVGAGNVTKLANQIVVAGNIAAMSEALVLATRAGADPDLVYQAIRGGLAGSTVLDAKAPLVMDGRFTPGFR 233 ***************************************************************************** PP TIGR01505 232 idlhqkdlalaldaakavgaalPvtavvaellaalradGdgtldhsalvraleklakdkv 291 i lh kd++++l++++++ + lP++a +e+++ l adG g++dh al+r ekla+++v lcl|FitnessBrowser__Miya:8502217 234 IRLHAKDMGNVLETSRELHVPLPLAAQLMEVMQGLMADGLGDADHGALIRHWEKLAGVEV 293 ********************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (291 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 22.82 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory