GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bztC in Desulfovibrio vulgaris Miyazaki F

Align BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate 8502073 DvMF_2786 polar amino acid ABC transporter, inner membrane subunit (RefSeq)

Query= TCDB::Q52665
         (434 letters)



>lcl|FitnessBrowser__Miya:8502073 DvMF_2786 polar amino acid ABC
           transporter, inner membrane subunit (RefSeq)
          Length = 596

 Score =  133 bits (335), Expect = 1e-35
 Identities = 103/295 (34%), Positives = 150/295 (50%), Gaps = 24/295 (8%)

Query: 140 TLLYPLAAFWLLWGGPIWGPVSVLAGFAILGLLFTALAPKLGVPVSAGIGLVVAALFWLY 199
           T   PLAA    WGG      +VLAG    GL    LA   G+  S G GL+     W  
Sbjct: 312 TTYTPLAAMLHQWGGYA-ARAAVLAG---KGLFVALLA---GLLYSVGKGLL--GFQWHV 362

Query: 200 AAAPIEAALQSALPLALPEVDSDQFGGFLLALVIGVTAIVVSLPLGILLALGRQSDMLIV 259
               + + L    P   P+      GG   +L++ V AI VS  +G+ + +GR S   + 
Sbjct: 363 VFENLRSLLIWHFPTGRPDEMFLGLGGLAYSLLMAVIAISVSFFIGLAVGVGRSSSNRVF 422

Query: 260 KSLSVGIIEFVRGVPLITLLFTASLLLQYFLPP--GTNFDLILRVVILVTLFAAAYIAEV 317
           +   +  IE +RG PLI ++F     + +F+P   GT  ++       +T F  AYIAE+
Sbjct: 423 RIPCLLYIELIRGNPLIIVIFW----VYFFIPVMFGTTLNVFWSATWALTAFTGAYIAEI 478

Query: 318 IRGGLAALPRGQYEAADALGLDYWQAQRLIIMPQALKISIPGIVSSFIGLFKDTTLVAFV 377
           +R G+  +P GQ EAA + GL Y QA R I++PQALK  IP IV  FI +FKDT+L   +
Sbjct: 479 VRTGIQNIPAGQVEAAYSTGLTYLQAMRRIVLPQALKQMIPAIVGQFIAIFKDTSLAFVL 538

Query: 378 GLFD---PLKGISNVVRSDMAWKGTYWEPYIFVALIFFLFNFSMSRYSMYLERKL 429
           G+ +     +GI+N +           E Y  VA ++F+  +SMS ++  LER+L
Sbjct: 539 GVLELTFVAQGINNRLMIHP------MEIYGTVAFLYFICCYSMSVFAARLERRL 587



 Score = 78.2 bits (191), Expect = 7e-19
 Identities = 50/153 (32%), Positives = 80/153 (52%), Gaps = 6/153 (3%)

Query: 233 IGVTAIVVSLPLGILLALGRQSDMLIVKSLSVGIIEFVRGVPLITLLFTASLLLQYFLPP 292
           I + +  ++L LG +L L R S    ++  +  +IEF R  PL+  LF         LP 
Sbjct: 67  ISLISSALALLLGTMLGLARLSLFRPLRVTATCVIEFFRNTPLLIQLFFWYFAFPAILPD 126

Query: 293 GTNFDLILR------VVILVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYWQAQRL 346
                L           I ++++ A+++AEVIR GL ++P+G  EAA + GL Y+Q  R 
Sbjct: 127 NAREALFSIQFEFWCATIGLSIYTASFMAEVIRAGLQSIPKGLLEAAYSSGLSYFQVLRT 186

Query: 347 IIMPQALKISIPGIVSSFIGLFKDTTLVAFVGL 379
           II+P A +  IP + S F+   K+++L   VG+
Sbjct: 187 IILPLAFRAIIPPLGSEFLNNMKNSSLAMVVGV 219


Lambda     K      H
   0.329    0.143    0.457 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 698
Number of extensions: 40
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 434
Length of database: 596
Length adjustment: 34
Effective length of query: 400
Effective length of database: 562
Effective search space:   224800
Effective search space used:   224800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory