Align Possible transporter of polar amino acids including glutamate, glutamine and aspartate, DmeA. It complements a sepJ mutation in Anabaena (TC# 2.A.7.23.2), and SepJ complements a dmeA mutation. Alternatively, and less likely, it could be an activator of an ABC transporter catalyzing uptake of these amino acids (characterized)
to candidate 8500801 DvMF_1542 protein of unknown function DUF6 transmembrane (RefSeq)
Query= TCDB::Q31PG5 (330 letters) >FitnessBrowser__Miya:8500801 Length = 292 Score = 184 bits (467), Expect = 2e-51 Identities = 115/286 (40%), Positives = 164/286 (57%), Gaps = 17/286 (5%) Query: 23 QLAIATALWGGTFTAGRIAVQQLSPLAVACGRYLLATTVLLLILWQREGW------PPLN 76 +L +AT WGGTF AGRIA P + A R+ +AT +L + +REG P ++ Sbjct: 6 KLMLATVFWGGTFVAGRIAAAHAGPFSAAFLRFAMATGLLFWYVRRREGALPRLTSPGMH 65 Query: 77 RRQQLLLFGLGVSGIALYNWLFFIGLSLIPASRAALIIALNPTAIALGAAIWTGDRLRSW 136 +LL LG +G+ YN LFF GL+ +PASRAA+I+ NP AIA+GAA++ G+ L Sbjct: 66 GWAGVLL--LGATGVFAYNALFFTGLATVPASRAAVIVTNNPIAIAVGAALFLGEPLSRR 123 Query: 137 QWAGVGLSLIGAILLLGSRQAGALTL----PGWGDLALVGCVLCWTVYSLLARQALRSLS 192 + AG+ LS+ GA++ + + LTL WGD+AL+GC+ W YSLL + +R+LS Sbjct: 124 KLAGILLSVGGAVIAI--TRGNPLTLFSSALSWGDVALLGCLASWAAYSLLGKVVMRALS 181 Query: 193 PLTVTTGACCWGSVLLIGLWLGQG--AQLPVNVSFSTGSAIAFLGLGGTALAFCLYANGI 250 PL T +C G+V+L+ L +G LP + A A+LG+ GT L F + + Sbjct: 182 PLAAVTWSCAVGTVMLLPFALHEGLWTALP-EYPAALWIAAAYLGVFGTVLGFTWFYEAV 240 Query: 251 ERLGAARAGLFINLVPVFGSAIGALLLQEPLSGLTLLGGLLVLAGV 296 + +GA RAG+FIN VP+ +L E L LLG LV GV Sbjct: 241 KEIGAGRAGVFINFVPLTAIVCAWAMLGEALPVSLLLGAALVTCGV 286 Lambda K H 0.325 0.142 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 292 Length adjustment: 27 Effective length of query: 303 Effective length of database: 265 Effective search space: 80295 Effective search space used: 80295 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory