GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gluD in Desulfovibrio vulgaris Miyazaki F

Align GluD aka CGL1953, component of Glutamate porter (characterized)
to candidate 8502073 DvMF_2786 polar amino acid ABC transporter, inner membrane subunit (RefSeq)

Query= TCDB::P48245
         (273 letters)



>lcl|FitnessBrowser__Miya:8502073 DvMF_2786 polar amino acid ABC
           transporter, inner membrane subunit (RefSeq)
          Length = 596

 Score =  109 bits (272), Expect = 2e-28
 Identities = 68/207 (32%), Positives = 120/207 (57%), Gaps = 11/207 (5%)

Query: 27  LPGLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETFRAIPVLILMIFAY 86
           L GL  +L  AV ++ ++  +G A+G+GR S  R+ R  C + IE  R  P++I++ + Y
Sbjct: 387 LGGLAYSLLMAVIAISVSFFIGLAVGVGRSSSNRVFRIPCLLYIELIRGNPLIIVIFWVY 446

Query: 87  QMFAQYNIVPSSQLAFAAVVFGLTMYNGSVIAEILRSGIASLPKGQKEAAIALGMSSRQT 146
             F    +  ++   F +  + LT + G+ IAEI+R+GI ++P GQ EAA + G++  Q 
Sbjct: 447 --FFIPVMFGTTLNVFWSATWALTAFTGAYIAEIVRTGIQNIPAGQVEAAYSTGLTYLQA 504

Query: 147 TWSILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEV--VRSGIQSASVNRNYLAALF 204
              I+LPQA+  M+PA++ Q +   KD++L + +G +E+  V  GI     NR  +  + 
Sbjct: 505 MRRIVLPQALKQMIPAIVGQFIAIFKDTSLAFVLGVLELTFVAQGIN----NRLMIHPME 560

Query: 205 V---VALIMIVLNFSLTALASRIERQL 228
           +   VA +  +  +S++  A+R+ER+L
Sbjct: 561 IYGTVAFLYFICCYSMSVFAARLERRL 587



 Score =  108 bits (270), Expect = 3e-28
 Identities = 75/220 (34%), Positives = 117/220 (53%), Gaps = 14/220 (6%)

Query: 26  ILPGLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETFRAIPVLILMIFA 85
           IL GL  T++ ++ S  LAL++GT LGL R+S  R LR     +IE FR  P+LI + F 
Sbjct: 57  ILKGLANTVRISLISSALALLLGTMLGLARLSLFRPLRVTATCVIEFFRNTPLLIQLFFW 116

Query: 86  YQMFAQYNIVP--------SSQLAFAAVVFGLTMYNGSVIAEILRSGIASLPKGQKEAAI 137
           Y  FA   I+P        S Q  F     GL++Y  S +AE++R+G+ S+PKG  EAA 
Sbjct: 117 Y--FAFPAILPDNAREALFSIQFEFWCATIGLSIYTASFMAEVIRAGLQSIPKGLLEAAY 174

Query: 138 ALGMSSRQTTWSILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEVVRSGIQSASVN- 196
           + G+S  Q   +I+LP A  A++P L S+ +  +K+S+L   +G  E+     Q  S+  
Sbjct: 175 SSGLSYFQVLRTIILPLAFRAIIPPLGSEFLNNMKNSSLAMVVGVAELTWHAQQVESLTF 234

Query: 197 ---RNYLAALFVVALIMIVLNFSLTALASRIERQLRAGRA 233
                  AA  +   + ++++F L  +  R+      GR+
Sbjct: 235 KGFEATSAATVLYLSLSLIISFILNGVNGRMRLDTAPGRS 274


Lambda     K      H
   0.323    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 369
Number of extensions: 27
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 2
Length of query: 273
Length of database: 596
Length adjustment: 31
Effective length of query: 242
Effective length of database: 565
Effective search space:   136730
Effective search space used:   136730
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory