Align GtrC aka GLNH aka SLL1104, component of Tripartite glutamate:Na+ symporter (characterized)
to candidate 8502446 DvMF_3152 extracellular solute-binding protein family 3 (RefSeq)
Query= TCDB::P74223 (296 letters) >FitnessBrowser__Miya:8502446 Length = 271 Score = 100 bits (250), Expect = 3e-26 Identities = 72/232 (31%), Positives = 118/232 (50%), Gaps = 10/232 (4%) Query: 66 LEAIRQRGKLRVGVKDNLRPLGFRDGQG-ELTGLEIALARRLALALLGDETAVELVPVQN 124 +E I+ RG L GVKD+ P G+ D Q ++ G +I + + +A L +EL V + Sbjct: 25 IEDIKARGALVCGVKDSTVPFGYIDEQSKQIVGFDIDICKAVADKL---GVKLELKTVTS 81 Query: 125 QDRLPLLLNGDVDLIIAQMGQNPARDRLVDFSPPYYMDGVG-LISKNSSLKNIDRNQAHT 183 R+P+L G VD++ A M RD ++DFS Y+MDG L+ K +K+ + Sbjct: 82 ATRIPMLTQGSVDMVAATMTHKFERDDVIDFSITYFMDGQKLLVKKGGGVKSAADLKGKK 141 Query: 184 IAVLNNSGTIPVIKQAFPQATLVGVDSYDQAYQILEQGQAMAFAGDNSVLSGWAQSQSD- 242 +A S + IK A P+AT+V D Y QA+ L+QG+A A D+++L G S + Sbjct: 142 VATAKGSTSEKNIKAAQPEATVVSFDEYPQAFLALKQGKAEAVTTDSTILLGLRNSDPEP 201 Query: 243 --YYHLPLQLTVNPLAIAMAKGLQHQALQREVNQTLLQLRASGWLRQQWQAW 292 + + ++ P + +A+ + VN+TL+ L SG + + W Sbjct: 202 DKWEIVGDYISPEPYGLGLAE--NDSKFRDLVNRTLVDLWNSGEYVKLYDKW 251 Lambda K H 0.322 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 271 Length adjustment: 26 Effective length of query: 270 Effective length of database: 245 Effective search space: 66150 Effective search space used: 66150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory