Align triokinase (EC 2.7.1.28); glycerone kinase (EC 2.7.1.29); FAD-AMP lyase (cyclizing) (EC 4.6.1.15) (characterized)
to candidate 8501867 DvMF_2582 dihydroxyacetone kinase subunit DhaK (RefSeq)
Query= BRENDA::Q3LXA3 (575 letters) >FitnessBrowser__Miya:8501867 Length = 354 Score = 233 bits (595), Expect = 7e-66 Identities = 137/348 (39%), Positives = 199/348 (57%), Gaps = 25/348 (7%) Query: 4 KKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHEPAH 63 KKL+N+V + L G+ A +P L++ R ++ +G+VA++SGGGSGHEP H Sbjct: 2 KKLINAVENVVREQLQGMAAAHPELRVNIDPHFVCRKEIP--QGKVAIVSGGGSGHEPMH 59 Query: 64 AGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLARE 123 GF+G GML G G VFTSP + +AV + G L IVKNYTGD +NF A E Sbjct: 60 GGFVGHGMLDGACPGEVFTSPTPDQMYECAKAVDRG--AGVLFIVKNYTGDVMNFETAAE 117 Query: 124 QARAEGIPVEMVVIGDDSAF-TVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEIAKQVN 182 A+G+ V+ ++I DD A L AGRRG+ TVL K+ GA AEAG L++ A Sbjct: 118 LCHADGLKVQNILIDDDVAVKDSLYTAGRRGVGTTVLAEKIVGAAAEAGYDLDKCADLCR 177 Query: 183 VVAKAMGTLGVSLSSCSVPGS-KPTFELSADEVELGLGIHGEAGVRRIKMATADEIVKLM 241 V + ++G++L+ C+VP + KPTFEL+ +E+E+G+GIHGE G +R M T DE+V++M Sbjct: 178 KVNQYGRSMGMALTPCTVPAAGKPTFELAENEIEIGIGIHGEPGTQRAPMKTVDELVQIM 237 Query: 242 ----------------LDHMTN---TTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIAD 282 LD ++ + + P G V+ VN++GG EL + Sbjct: 238 ATTIIDDPAYTRTVRELDRVSGQWVDKSLTDAPFAKGDKVIAFVNSMGGTPVSELYAVYR 297 Query: 283 ATVRSLEGRGVKIARALVGTFMSALEMPGISLTLLLVDEPLLKLIDAE 330 RG+ I R L+G ++++LEM G S+TLL VD+ +LK DA+ Sbjct: 298 KLAEICGARGISIVRNLIGPYITSLEMQGFSITLLKVDDEILKFWDAK 345 Lambda K H 0.315 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 575 Length of database: 354 Length adjustment: 33 Effective length of query: 542 Effective length of database: 321 Effective search space: 173982 Effective search space used: 173982 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory