Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate 8499890 DvMF_0655 ABC transporter related (RefSeq)
Query= TCDB::G3LHY8 (358 letters) >FitnessBrowser__Miya:8499890 Length = 350 Score = 167 bits (423), Expect = 4e-46 Identities = 111/347 (31%), Positives = 170/347 (48%), Gaps = 15/347 (4%) Query: 2 LELRNAAKMVGADYHIYPTDLVLERGTLNVLLGPTLAGKTSLMRLMAGLDRPTGGSIHFD 61 ++L N ++ G + +E+GT+ VLLGP+ GK++ +RL+AGL+ T G I Sbjct: 4 IQLLNVSRHWGDVRAVDDVSFEVEQGTMLVLLGPSGCGKSTTLRLIAGLESVTSGRIMIG 63 Query: 62 GTDVTGMPVQKRNVAMVYQQFINYPALTVYNNIASPMRISGKDAATIDREVRKAAELLKL 121 DVT +P +R +AMV+Q + +P LTV NI + + A ++ + +A ++L L Sbjct: 64 ERDVTHLPPAQRQLAMVFQSYALFPHLTVRENILFGLTVRKVPEAEREKRLTRAVDILGL 123 Query: 122 TPYLDRTPLNLSGGQQQRTALARALVKNASLVLMDEPLANLDYKLREELREELPKIFAQS 181 + L R P LSGGQQQR AL RALV A++ LMDEPL+NLD KLR E+R E+ + Sbjct: 124 SALLQRKPGELSGGQQQRVALGRALVAEAAVCLMDEPLSNLDAKLRHEMRREIRALQQTL 183 Query: 182 GAIFVYATTEPSEALLLGGNTATLNQGRVTQFGPTIEVYRRPVNLATAGIFADPPLNTL- 240 G VY T + +EA+ + + GR+ Q E+Y RP PP+N + Sbjct: 184 GMTMVYVTHDQTEAMSMADRIILMQGGRIVQNATPSELYSRPATTFAGNFIGTPPMNLVR 243 Query: 241 --DVTKSGNVFTRPSGVTIPVPSHLAVVPDGPVTIAFHPHHLGLAPQTGDAARLQARTLV 298 D S V SG ++VV + P H+ + P+ G A +++ Sbjct: 244 LDDARGSVCVAGSRSGT-------VSVVDSADYVLGIRPEHIRIVPE-GWRAVVES---- 291 Query: 299 SEITGSESFVHLEYDGVRWVMLAHGIHDIDPDMEVEAFLDTRHLMAF 345 E GS S + G ++ G+ I E+ H+ F Sbjct: 292 VEYLGSGSVLGCRVGGEELSVVVDGVPTIAVGAEIYLHCPDEHIHIF 338 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 350 Length adjustment: 29 Effective length of query: 329 Effective length of database: 321 Effective search space: 105609 Effective search space used: 105609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory