Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate 8500849 DvMF_1587 ABC transporter related (RefSeq)
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >FitnessBrowser__Miya:8500849 Length = 366 Score = 158 bits (399), Expect = 2e-43 Identities = 101/292 (34%), Positives = 160/292 (54%), Gaps = 17/292 (5%) Query: 27 LKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLVPSHGKVLFDGRDVTRA------SPQER 80 L + G + LLGPSGCGKT +L +++G P G + G V+ A P R Sbjct: 22 LSLTVNHGECFTLLGPSGCGKTVLLRLIAGFETPDAGTISIGGEPVSDAVTGDCVPPDAR 81 Query: 81 NIAQVFQFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRVGVIAEMLEMSGQLNQRAAGLA 140 ++ VFQ ++ M+VA+N+ +PL+ +P + ++V EM+ ++G N+ + L+ Sbjct: 82 DLGVVFQDYAVWPHMSVADNIGYPLKLAGLPAAERTRQVLETVEMVNLTGLENRMPSQLS 141 Query: 141 ADAKQKISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQ 200 +Q+++L R LV + +L DEPL +D +L+ ++R ++K++ L +T++YVTHDQ Sbjct: 142 GGQQQRVALARALVGRP-SLMLLDEPLCNLDANLREEMRFEIKELQRTLGITILYVTHDQ 200 Query: 201 VEALTFADQVVVMTRGKAV-QVGSADALFERPAHTFVGHFIGSPGMNFLPAHRDGENLSV 259 AL +D++ +M A+ QVG+ +FERPA FV F+G NFLPA R G + Sbjct: 201 EIALAISDRLAIMDHAGAIRQVGTPWEIFERPADEFVFRFMGV--ANFLPARRRGMAMLA 258 Query: 260 AGHRLASPVGRALPAGALQ---VGIRPEYLALAQPQQAGALPGTVVQVQDIG 308 AG PV LP G + G RP + LA +Q L GTV + +G Sbjct: 259 AGGE--QPVPWGLPDGDAEHWMAGFRPSDVRLA--RQGDGLRGTVRRASFLG 306 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 366 Length adjustment: 29 Effective length of query: 329 Effective length of database: 337 Effective search space: 110873 Effective search space used: 110873 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory