Align ABC transporter for L-Histidine, periplasmic substrate-binding component 1 (characterized)
to candidate 8500097 DvMF_0860 extracellular solute-binding protein family 3 (RefSeq)
Query= reanno::acidovorax_3H11:Ac3H11_2555 (249 letters) >FitnessBrowser__Miya:8500097 Length = 246 Score = 100 bits (248), Expect = 4e-26 Identities = 75/240 (31%), Positives = 115/240 (47%), Gaps = 17/240 (7%) Query: 14 AAAFCTTGAQAQDNVLRVGTDATFPPMEFVENGKR-TGFDIELVEAIAKTMGKQVEWVDI 72 AA T + + V DAT+PPMEFV+ K GF ++ +A+AK G ++ ++ Sbjct: 10 AALLVTANVAFAEKTIVVAQDATWPPMEFVDANKNLVGFSVDYTDAMAKEAGFKIVHKNV 69 Query: 73 DFKGLIPGLISKRFDMAVSAIYITDERKKVVDFTDSYY-AGGLVVMVKADNKAINKLADL 131 + G+ GL S +D VS++ ITDERK +DFT YY +V+ K N + KL ++ Sbjct: 70 AWDGIFAGLESGSYDAIVSSVSITDERKNAMDFTAPYYEVRQALVVPKTTN--VTKLDEM 127 Query: 132 DGKKVSVQVGTKSVSYLTEKFPKVQRVEVEKNQEM-FNLVDI--GRADAAVTGKPAAFQY 188 GK + Q+ T Y T K K V + E+ + D+ GR D V P A Y Sbjct: 128 KGKTLGGQIST--TGYFTIK--KTAGVTAKSYDEIGLAMEDLFNGRIDGVVCDDPVAASY 183 Query: 189 V------RTRPGLRVLDEQLTTEEYGMALRKDTPELTKAVNGAITKLKADGTYAAIVKKW 242 + + + E E YG+A++K E+ +N I +KA G + +KW Sbjct: 184 ALQQEQYAAKMKIAFVIETQEKEFYGIAVKKGNKEVLDLLNKGIAAVKAKGIDKQLREKW 243 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 246 Length adjustment: 24 Effective length of query: 225 Effective length of database: 222 Effective search space: 49950 Effective search space used: 49950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory