Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate 8500039 DvMF_0802 ABC transporter related (RefSeq)
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >FitnessBrowser__Miya:8500039 Length = 434 Score = 200 bits (508), Expect = 5e-56 Identities = 99/257 (38%), Positives = 162/257 (63%), Gaps = 7/257 (2%) Query: 4 VSIQAVSRVFETAKGQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSG 63 V+++ + + + + +R A+ V+ E+ + +FV +LGPSGCGKSTLLR++ GL T G Sbjct: 6 VTLRGLGKAYGSG-ARRFTAVSGVNLEIAEGEFVALLGPSGCGKSTLLRMITGLIAPTEG 64 Query: 64 RVLLDGAPVEGPGAERGMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKV 123 VL G +EG +VFQ++ LFPWLT+++N+ L+ RG+P + RA + +V Sbjct: 65 EVLYRGGRLEGVNPHATIVFQTFALFPWLTVQENVEVVLKARGVPPRVRARRALDLLDRV 124 Query: 124 GLRGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWE 183 GL GF+ +P++LSGGM+Q+ ARA+A +P++L +DEPF ALD + ++ LL +W Sbjct: 125 GLAGFDNAYPRELSGGMRQKVGFARAMAVEPELLCLDEPFSALDVLSAETLRGELLELWT 184 Query: 184 AER---KTVLFVTHDIDEAIFMANRVAVFSARPGRIKTELAVDLPHPRHYTIKTSPEFMD 240 + + + +L V+H+IDEA+FMA+R+ + PG I + VDLPHPR + SPE++ Sbjct: 185 SGKIPTRAILMVSHNIDEAVFMADRIVIMDKDPGHIVRVMPVDLPHPRQ---RKSPEYLA 241 Query: 241 LKARLTEEIRAESMAAD 257 R+ + +++ D Sbjct: 242 FVDRVYALLAGQTLTED 258 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 434 Length adjustment: 28 Effective length of query: 231 Effective length of database: 406 Effective search space: 93786 Effective search space used: 93786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory