Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate 8499364 DvMF_0141 dTDP-glucose 4,6-dehydratase (RefSeq)
Query= BRENDA::F2NQX6 (314 letters) >FitnessBrowser__Miya:8499364 Length = 340 Score = 123 bits (309), Expect = 5e-33 Identities = 101/324 (31%), Positives = 148/324 (45%), Gaps = 25/324 (7%) Query: 1 MRVLVTGGAGFIGSHLVHALHQKGIPVAVLD-----------DLSTGKRAHIPPDVPLYQ 49 MR+LVTGG GFIG++ V + + V V++ +L+ ++ H Sbjct: 1 MRLLVTGGCGFIGTNFVRLVIDRRPDVTVVNLDKLTYAGNPLNLADVEKTHGGTRYFFEH 60 Query: 50 TDIRDLNAVLHAFQDFQPTHVAHQAAQASVKHSVQNPCKDAEINLLGGLNILEAMRATGT 109 DI D +AV + V + AA+ V S+ +P N+LG +L A R G Sbjct: 61 ADIADADAVRRILAQHRIDAVVNFAAETHVDRSIDDPAPFVVTNVLGTQTLLTAAREAGV 120 Query: 110 QKIVFASTGGAIYGEV-PEGRRAPETWPPKPKSPYAASKAAFEHYLEVYRQTHGLTYTTL 168 + V ST +YG + PEGR T P P SPY+ASKAA + + +T+G Sbjct: 121 TRFVHVSTD-EVYGTLGPEGRFTEST-PLAPNSPYSASKAAGDLMARAWFETYGYPVVIT 178 Query: 169 RYANVYGPRQDPHGEAGVVAIFTNRLLHAQPVTLYARKEPGDPGCIRDYIHVEDVTRANL 228 R +N YGP Q P ++ + R + + +Y GD +RD+IHV+D R L Sbjct: 179 RCSNNYGPYQFPE---KLIPLMIGRAGRDETLPVY-----GDGMNVRDWIHVDDHCRGVL 230 Query: 229 LALETNLEG-TYNVSTGQGRTTEDVLYTIARALGTTPR-VTYAPPRDG-DLEVSVLDPTQ 285 LALE G YN R V+ I R +G + + R G D ++ Sbjct: 231 LALEKGRPGAVYNFGGAAERPNIKVVRAILRLVGKPESLIRHVTDRPGHDRRYAMDFSLA 290 Query: 286 LQAHGWRPQVPFEEGIRRTVAWFR 309 Q G+ P+ FE G+ TVAW+R Sbjct: 291 AQELGYTPEYDFERGLAETVAWYR 314 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 340 Length adjustment: 28 Effective length of query: 286 Effective length of database: 312 Effective search space: 89232 Effective search space used: 89232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory