Align UDP-glucose 4-epimerase (EC 5.1.3.2); UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) (characterized)
to candidate 8501561 DvMF_2280 NAD-dependent epimerase/dehydratase (RefSeq)
Query= BRENDA::Q9WYX9 (309 letters) >FitnessBrowser__Miya:8501561 Length = 342 Score = 191 bits (486), Expect = 2e-53 Identities = 120/328 (36%), Positives = 185/328 (56%), Gaps = 26/328 (7%) Query: 4 LVTGGAGFIGSHVVDKLIENGYGVIVVDNLSSGKVENLN-----------RNALFYEQSI 52 LVTG AGFIGS++++ L+ +G V+ +DN ++G NL+ RN F E I Sbjct: 19 LVTGVAGFIGSNLLETLLMHGQKVVGLDNFATGYQRNLDMVREIVGADLWRNFRFKEGDI 78 Query: 53 EDEEMMERIFSLHRPEYVFHLAAQASVAISVREPARDAKTNIIGSLVLLEKSIKYGVKKF 112 + E + ++V H AA SV S+ +P ++NI G + ++ + VK F Sbjct: 79 RNLEHCREV--CEGVDHVLHQAALGSVPRSIEDPILANESNISGFVNMMVAARDAKVKTF 136 Query: 113 IFSSTGGAIYGENVKVFPTPETEIPHPISPYGIAKYSTEMYLEFFAREYGLKYTVLRYAN 172 +++++ YG+ P E +I P+SPY + KY E+Y + FA YG+K LRY N Sbjct: 137 VYAASSST-YGDE-PTLPKVEDKIGKPLSPYAVTKYVNELYADVFATCYGMKAIGLRYFN 194 Query: 173 VYGPRQDPYGE-AGVVAIFTERMLRGEEVHIFGDGEYVRDYVYVDDVVRANLLAMEKGD- 230 V+G RQDP+G A V+ + +LRGE V I GDGE RD+ Y+D+ V+ANLLA D Sbjct: 195 VFGKRQDPFGAYAAVIPQWFASLLRGETVFINGDGETSRDFCYIDNCVQANLLAATATDE 254 Query: 231 ---NEVFNIGTGRGTTVNQLFKLLKEITGYDK------EPVYKPPRKGDVRKSILDYTKA 281 N V+N+ G T +NQLF L++E K +P ++ R GDVR S+ D ++A Sbjct: 255 AALNTVYNVAFGERTDLNQLFDLIREEVSRHKPEAATAKPEHREFRFGDVRHSLADISRA 314 Query: 282 KEKLGWEPKVSLEEGLKLTVEYFRKTLE 309 +LG+EP S+ +GL+L+ +++ L+ Sbjct: 315 HTRLGYEPVYSVRQGLRLSGDWYAANLK 342 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 342 Length adjustment: 28 Effective length of query: 281 Effective length of database: 314 Effective search space: 88234 Effective search space used: 88234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory