Align ABC transporter permease (characterized, see rationale)
to candidate 8500740 DvMF_1483 inner-membrane translocator (RefSeq)
Query= uniprot:A0A165KC95 (309 letters) >FitnessBrowser__Miya:8500740 Length = 295 Score = 180 bits (457), Expect = 3e-50 Identities = 106/302 (35%), Positives = 164/302 (54%), Gaps = 18/302 (5%) Query: 1 MDILLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGA 60 ++ L Q ++GL GS+YAL+ALGY++++ ++NF G+ L +G L +S + Sbjct: 6 INALAQYTLSGLTTGSVYALLALGYSLIFNATGIVNFTQGDFLSLGGLVLYSLL-----V 60 Query: 61 MPGAPGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAM 120 G P V ATI+ +A L +E+V RP RS + + + S L++ L Sbjct: 61 SQGLP-IVAAFPATILVVALAGAL---VERVCLRPARSRQMIILIFITMAASTLMRGLMK 116 Query: 121 IIWKPNYKPYPTMLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAMRAT 180 W P + P PF + GA +TP + ++G+T +A+L + T G+AMRA Sbjct: 117 EGWGKLPLALPPLSPEVPFRLLGAVLTPQNLWVMGMTLCGIAALAWFFRATVTGKAMRAA 176 Query: 181 AENPRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAV 240 A +PR A LMGV+ + + + +F L A+ G M + + + +G + GLK F AAV Sbjct: 177 AADPRTARLMGVEVERLTTLSFAFAGALGALGG-MLITPITSLSYDIGLMLGLKGFAAAV 235 Query: 241 FGGIGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGL 300 GG G+ AGAV GG+LLGL E+ G+GY+ S Y D+ F +LI++L +RP GL Sbjct: 236 LGGYGSFAGAVAGGVLLGLFESYGAGYV--------TSAYRDVLVFGLLILVLFVRPQGL 287 Query: 301 LG 302 G Sbjct: 288 FG 289 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 295 Length adjustment: 27 Effective length of query: 282 Effective length of database: 268 Effective search space: 75576 Effective search space used: 75576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory