Align NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate 8501893 DvMF_2608 inner-membrane translocator (RefSeq)
Query= TCDB::Q8YXD0 (288 letters) >FitnessBrowser__Miya:8501893 Length = 302 Score = 136 bits (343), Expect = 5e-37 Identities = 83/288 (28%), Positives = 158/288 (54%), Gaps = 13/288 (4%) Query: 7 QLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAYLTFFV-NTFGVN----- 60 +L G+ GSI AL A+G T+ YGI+ L NFAHG+ +GA+ V G+ Sbjct: 8 ELFFGGLTRGSIYALIALGYTMVYGIIELINFAHGEVYMMGAFTALIVAGALGIYGFPAL 67 Query: 61 --IWLSMIVAVVGTVGVMLLSEKLLWSRMRSIRANSTTLIIISIGLALFLRNGIILIWGG 118 + ++ +VAV+ L EK+ + +R A + +I +IG+++FL+N +IL Sbjct: 68 AILIIAAVVAVIYCAAYGLTLEKIAYKPLRD--APRLSPLISAIGMSIFLQNYVILAQTS 125 Query: 119 RNQNYN--LPITPALDIFGVKVPQNQLLVLALAVLSIGALHYLLQNTKIGKAMRAVADDL 176 + +P L+ + +++L++ + +S+ AL ++ T++GKAMRA A + Sbjct: 126 DFMPFPNLVPQPDFLEPIAHIMGASEVLIIVTSAISMAALTLFIKYTRMGKAMRATAQNR 185 Query: 177 DLAKVSGIDVEQVIFWTWLIAGTVTSLGGSMYGL-ITAVRPNMGWFLILPLFASVILGGI 235 +A + GID ++VI T++I ++ ++GG + + V +G+ + F + +LGGI Sbjct: 186 KMAMLLGIDADKVISLTFVIGSSLAAVGGVLIASHVGQVNFAIGFIAGIKAFTAAVLGGI 245 Query: 236 GNPYGAIAAAFIIGIVQEVSTPFLGSQYKQGVALLIMILVLLIRPKGL 283 G+ GA+ ++G + +T ++ S Y+ +A +++L+L+ RP G+ Sbjct: 246 GSIPGAMLGGLVLGWCESFATGYISSDYEDALAFALLVLILIFRPSGI 293 Lambda K H 0.328 0.144 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 302 Length adjustment: 26 Effective length of query: 262 Effective length of database: 276 Effective search space: 72312 Effective search space used: 72312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory