Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate 8501786 DvMF_2502 glutamate-1-semialdehyde aminotransferase (RefSeq)
Query= SwissProt::Q5JEW1 (445 letters) >FitnessBrowser__Miya:8501786 Length = 425 Score = 130 bits (326), Expect = 1e-34 Identities = 103/338 (30%), Positives = 153/338 (45%), Gaps = 34/338 (10%) Query: 14 KAKEVIERNFKYLAMTTQDP-------ENLPIVIERGEGIRVYDVDGNVFYDFASGVGVI 66 ++KE+ ER + + P ++ P+ + +G + VDG F D+ G + Sbjct: 4 RSKELFERAQQLIPGGVNSPVRACLGVDSDPLFVAHAKGSHLTTVDGTSFVDYVQSWGPM 63 Query: 67 NVGHSHPRVVEAIKKQAEKFTHYSLTDFFYENAIILAEKLIELAPGDIERKVVYGNSGAE 126 +GH+HP V AI ++ T Y E+ ++LAE +I+ PG ++V NSG E Sbjct: 64 LLGHAHPVVASAIHAAVDRGTSYGAP---CEDEVVLAEAVIDALPGVEMVRMV--NSGTE 118 Query: 127 ANEAAMKLVKYGTGRKQFLAFYHAFHGRTQAVLSLTASKWVQQDGFFPTMPGVTHIPYPN 186 A +A++L + TGR + + F +HG A L+ S GV + P Sbjct: 119 ATMSALRLARGVTGRNKVVKFVGCYHGHADAFLASAGS-------------GVATLSIPG 165 Query: 187 PYRNTWGIDGYEEPDELTNRVLDFIEEYVFRHVPPHEIGAIFFEPIQGEGGYVVPPKGFF 246 T G+ D L D + +I AI EP+ G G V+P GF Sbjct: 166 ----TPGVPEATVRDTLLAPYNDLTAVAELFTLHGKDIAAIIVEPVAGNMGLVLPMNGFL 221 Query: 247 KALKKFADEYGILLADDEVQMGIGRTGKFWAIEHFGVEPDLIQFGKAIGGGLPLAGVIHR 306 + L+ E+G LL DEV G R A + F + PDL GK IGGGLP+ R Sbjct: 222 QGLRDLCTEHGALLIFDEVITGF-RVNYGGAQKRFDITPDLTTLGKIIGGGLPVGAYGGR 280 Query: 307 ADI--TFDKPGR--HATTFGGNPVAIAAGIEVVEIVKE 340 AD+ G A T GNP+A+AAGI + +K+ Sbjct: 281 ADLMRRIAPCGEVYQAGTLSGNPLAMAAGIATLAELKK 318 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 425 Length adjustment: 32 Effective length of query: 413 Effective length of database: 393 Effective search space: 162309 Effective search space used: 162309 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory